KEGG   Thermodesulfatator indicus: Thein_0069Help
Entry
Thein_0069        CDS       T01546                                 

Definition
(GenBank) ParB domain protein nuclease
  KO
K03497  
chromosome partitioning protein, ParB family
Organism
tid  Thermodesulfatator indicus
Brite
Transcription factors [BR:tid03000]
 Prokaryotic Type
  Other transcription factors
   Others
    Thein_0069
Chromosome [BR:tid03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Thein_0069
Cytoskeleton proteins [BR:tid04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   Thein_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(71846..72778)
Genome map
AA seq 310 aa AA seqDB search
MKIDLKSVSLQEVLFEDETFAISYPPRVVFLIESIKRIGIINPPILRPSPRGLQIVSGRG
RLEAARELKIEKVTCNVLPYETGDTFCLDLVIEENLTSRGLNLVEKALVVRKYHTYLTDE
RIIKEVLPRLGFAPHYHHFEVLKAIASLGDMAWNFLIENRLNPKVAVKLAGLDKVNQKKF
LEILSKLKLSSSRQRLFWEMLEDLSRKKAQSFKQIIEEISVTSLLNEERLSPHQKTEKLF
KQLAKELMPVYSAREAKIKKISSRLHELGAKIKFTPFLEKDSMCLEINFKSAEEIEKKWP
KIREIIGEEF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattgaccttaaatctgttagcttgcaagaagtccttttcgaagatgaaacattt
gccatatcctatcctcctcgggtagttttcttaatcgaatccataaagcgtataggcatt
attaaccctccgattttaaggccaagtccaagagggctccaaatagtttctggccgaggc
cggcttgaggcagccagagaattaaaaattgaaaaggtcacttgcaatgttcttccctat
gagacgggtgatactttttgtttggacctagtgattgaagaaaatcttacttcacgcggc
ctgaacctggtagaaaaggctttagtagtaagaaaatatcatacctatctaaccgatgaa
agaataataaaagaggttttgccacgcctcggctttgctcctcattatcatcattttgag
gttttaaaagccatagcttctttaggagatatggcctggaattttttgatagagaatcgc
ttgaatcctaaggtggcggttaagctagcagggcttgataaagtaaatcaaaaaaaattt
ttagagattttgagtaagcttaagctttcaagtagcaggcaacgtttattctgggagatg
ttagaagatctaagtcgtaaaaaggcgcaaagttttaaacaaataatcgaagaaatttct
gtaacatctcttttaaatgaagaaagactttctcctcatcaaaaaacagaaaaacttttt
aagcaattggccaaagaattaatgcctgtttattcggctagagaagcaaaaatcaagaag
atttccagtcgtttgcatgaactaggagcaaaaatcaagtttactccttttttagaaaag
gattctatgtgtcttgaaattaattttaagagtgccgaggaaatagaaaagaaatggccc
aaaattagagaaattatcggtgaggagttttag

DBGET integrated database retrieval system