KEGG   Thermodesulfatator indicus: Thein_0076Help
Entry
Thein_0076        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF147
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DisA_N
Motif
Other DBs
NCBI-ProteinID: AEH43961
UniProt: F8AE36
Position
complement(77377..78177)
Genome map
AA seq 266 aa AA seqDB search
MKDLLRQYYHLLRWQDIVDILIVAYLFYRILLLIRGTRAIQMAAGLAMLVMMYFVAANLQ
LLTLHWLLGTFLSSIFLVVIIVFQDDIRRALIQMGQTPFIKARTEYSQIIEEIVKAVATL
SEKKIGALIVIERNTGLGEFIESGTPIEARVTRDLLISIFQKNSPLHDGAVIIREGRIAV
AGAILPLSTNPKISRRLGTRHRAAIGISEVSDAVAIVVSEETGSISVALGGKINRDIQPS
NLRQLLLNLLGFESGQNKWWRRKIFK
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagacctcctcaggcagtattatcatctcctccgctggcaagacatcgttgacata
ctcattgtagcttatcttttttaccgtattcttttgttgatccgtggaactcgagctatt
caaatggcagctgggctggccatgttggtgatgatgtattttgtggccgccaatctccag
ttgctcactcttcactggcttttaggaacgtttctttcttcgatttttttggtagtgatt
atagtttttcaggacgatattagacgggcccttatccagatggggcagacaccgtttatt
aaagctcggaccgaatatagccaaattattgaagaaatagtaaaggcagtagccactctt
tctgaaaaaaaaattggggcattaatagttatagaaaggaataccgggcttggggagttt
attgaaagtggaacccctattgaggccagagttactagagatcttttaatatcgattttt
cagaaaaattctcccctccatgacggagctgttattattagagaaggccgaatagcagtg
gctggagctattttacctttgtctactaatcctaaaattagtcgtcgtctggggaccaga
catagggcggctataggtatttctgaagttagtgatgcagtggctattgtagtttccgaa
gagacaggaagcatttcagtagctcttgggggcaagataaatagagatattcagccttct
aacttgagacagcttttgctaaacctgcttggttttgaatcaggtcaaaataaatggtgg
cggagaaagatttttaaatga

DBGET integrated database retrieval system