KEGG   Thermodesulfatator indicus: Thein_0077Help
Entry
Thein_0077        CDS       T01546                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00790  Folate biosynthesis
tid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thein_0077
Enzymes [BR:tid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Thein_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind DUF561 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AEH43962
UniProt: F8A8F7
Position
complement(78174..79016)
Genome map
AA seq 280 aa AA seqDB search
MLKPLKVRNKVFEWGKKTYLVGVLNVTPDSFSDGGLYLNPKQALKRAEEMIEAGVDIIDI
GGESTRPFAKPVPEEEEIKRTIPIIEAIRKYWDIPISIDTYKAGVAEKALKAGADVVNDI
SALRFDPRMAEVVAKNGVPVILMHMKGNPQTMQLDPYYEDVLSEISSFFEERVAFAEGAG
IAREKIIIDPGLGFGKRFEDNLKIIKEIDFFKKYRLPILIGPSRKSFIGHIVNKEARERD
AGTMATVAYLSLKKVDLIRVHNVAMARDVIKVIEAIREVR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcctcttaaagttagaaacaaggtttttgaatggggtaaaaaaacttatttg
gtaggtgttttgaacgttaccccggattccttttctgatggggggctctacttaaatccc
aaacaagcccttaagcgggccgaagaaatgatagaggctggagttgatataattgatatt
ggcggcgaatctactagaccttttgctaagccagttcctgaagaagaagagatcaagaga
actatcccgataatcgaggctattaggaaatattgggatattcctatttctattgacaca
tataaggccggagtagccgaaaaagcccttaaagctggcgcggatgtagttaatgacatt
agtgctctacgttttgatcctcgtatggccgaagtagtggccaaaaacggggtgccggta
attcttatgcatatgaaggggaacccccagactatgcagcttgatccatattatgaagac
gtcctttcggaaatcagctccttttttgaggaaagggtggcttttgccgaaggagctggt
atcgcgcgggaaaaaattataattgatcctggtttgggctttggtaaaaggtttgaagat
aatttaaaaatcatcaaagaaatagacttttttaaaaaatatagactacccatcctaata
ggaccttcaagaaaatcatttattggtcatatagtaaacaaagaggcccgagaaagagat
gccggcaccatggctacagttgcttatctctctttaaagaaagtggatttaataagagtt
cacaacgtagccatggctcgcgatgttattaaagttattgaagccataagggaggttagg
tga

DBGET integrated database retrieval system