KEGG   Thermodesulfatator indicus: Thein_0077Help
Entry
Thein_0077        CDS       T01546                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tid  Thermodesulfatator indicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thein_0077
Enzymes [BR:tid01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Thein_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(78174..79016)
Genome map
AA seq 280 aa AA seqDB search
MLKPLKVRNKVFEWGKKTYLVGVLNVTPDSFSDGGLYLNPKQALKRAEEMIEAGVDIIDI
GGESTRPFAKPVPEEEEIKRTIPIIEAIRKYWDIPISIDTYKAGVAEKALKAGADVVNDI
SALRFDPRMAEVVAKNGVPVILMHMKGNPQTMQLDPYYEDVLSEISSFFEERVAFAEGAG
IAREKIIIDPGLGFGKRFEDNLKIIKEIDFFKKYRLPILIGPSRKSFIGHIVNKEARERD
AGTMATVAYLSLKKVDLIRVHNVAMARDVIKVIEAIREVR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagcctcttaaagttagaaacaaggtttttgaatggggtaaaaaaacttatttg
gtaggtgttttgaacgttaccccggattccttttctgatggggggctctacttaaatccc
aaacaagcccttaagcgggccgaagaaatgatagaggctggagttgatataattgatatt
ggcggcgaatctactagaccttttgctaagccagttcctgaagaagaagagatcaagaga
actatcccgataatcgaggctattaggaaatattgggatattcctatttctattgacaca
tataaggccggagtagccgaaaaagcccttaaagctggcgcggatgtagttaatgacatt
agtgctctacgttttgatcctcgtatggccgaagtagtggccaaaaacggggtgccggta
attcttatgcatatgaaggggaacccccagactatgcagcttgatccatattatgaagac
gtcctttcggaaatcagctccttttttgaggaaagggtggcttttgccgaaggagctggt
atcgcgcgggaaaaaattataattgatcctggtttgggctttggtaaaaggtttgaagat
aatttaaaaatcatcaaagaaatagacttttttaaaaaatatagactacccatcctaata
ggaccttcaagaaaatcatttattggtcatatagtaaacaaagaggcccgagaaagagat
gccggcaccatggctacagttgcttatctctctttaaagaaagtggatttaataagagtt
cacaacgtagccatggctcgcgatgttattaaagttattgaagccataagggaggttagg
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system