KEGG   Thermodesulfatator indicus: Thein_0085Help
Entry
Thein_0085        CDS       T01546                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tid  Thermodesulfatator indicus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thein_0085
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Thein_0085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(85394..85996)
Genome map
AA seq 200 aa AA seqDB search
MRKGLVLVVSAPSGAGKTTLCRRLLSLDSEISFSVSYTTRSPRPNERNGVDYFFVDKETF
KKMINEGAFLEWAEVHGNFYGTSLEQVKEAISSGKDVLLDIDVQGAFQVREKLGREAVLV
FILPPSFEELEKRLKKRGTEDPKELELRLSVAKEEIAKAQAFDYLIVNDVLEEALDRLYS
ILKAERQRTFRRSDLIMRFF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaggtttggtcttagtagtctcggccccttctggggccggcaaaactaccctt
tgtcgccgtttactttctcttgactcagagatttctttttcagtctcttacaccaccaga
tcacctcgccctaatgaaagaaatggtgttgattatttttttgtagataaagagactttt
aaaaagatgataaatgaaggtgcctttctcgagtgggctgaggtacacggaaacttctat
ggcacctcccttgaacaggtaaaagaggctatctcttcagggaaagatgttttgcttgac
atagatgttcaaggggcttttcaggttagagaaaagctcggtagagaagctgttttagtc
tttattttaccaccctcttttgaagaacttgaaaagcgacttaaaaaacgaggcactgaa
gaccctaaagaacttgagctcaggctttcagtggccaaagaagaaatagccaaggcccag
gcctttgactatttgatcgttaatgatgttttagaagaggctctcgataggttgtattct
attttgaaggcagaaagacagcgcacgttccgccgaagtgaccttattatgaggtttttt
taa

DBGET integrated database retrieval system