KEGG   Thermodesulfatator indicus: Thein_0090Help
Entry
Thein_0090        CDS       T01546                                 

Definition
(GenBank) outer membrane chaperone Skp (OmpH)
  KO
K06142  
outer membrane protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
88550..89077
Genome map
AA seq 175 aa AA seqDB search
MKRLAILIVFGILLLSTNSWATEAKIGVVDIQTVVRNSQAGQEALKKLQAKFETLKAKLQ
KKESELRKFKTELEKKAPLLSPEARKEKEREYQKMLREYQAAREDAQFEMKQEEEKALKP
IMQDLDKIIKDMAKKEGYDLILEKRMPGLYWASEKIDITKHLIELYNKYWTTKKK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggctggcaattttaatagtttttgggattttacttttgagtacaaatagctgg
gccactgaagccaaaattggcgtggttgatatccagacagtagtcagaaactctcaggcc
gggcaagaggctcttaaaaaacttcaggccaagtttgaaactttaaaagccaaactccaa
aaaaaagaaagcgaattacgtaaatttaaaacagaacttgaaaagaaagcgcctctcctc
tccccagaggcacgcaaagaaaaagaacgggaataccaaaaaatgctaagagaatatcag
gccgccagagaagatgcccagtttgaaatgaagcaagaagaagaaaaggccttaaaaccc
ataatgcaggatttagataaaataataaaagacatggctaaaaaagaaggttacgacctt
atccttgaaaaaaggatgcccgggctttattgggcttcagaaaaaatagacattaccaaa
catttgattgaactttacaacaagtactggaccaccaagaaaaagtaa

DBGET integrated database retrieval system