KEGG   Thermodesulfatator indicus: Thein_0095Help
Entry
Thein_0095        CDS       T01546                                 

Definition
(GenBank) indolepyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00179  indolepyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.8]
Organism
tid  Thermodesulfatator indicus
Brite
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.8  indolepyruvate ferredoxin oxidoreductase
     Thein_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C POR_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: AEH43980
UniProt: F8A8H1
Position
complement(92549..94243)
Genome map
AA seq 564 aa AA seqDB search
MHPLIEARAGQKLLLLGNEAIARGALEAGLRVGAAYPGTPSSEIGNNLFQIQHELPGLYF
EFSTNEKVAMEVAAAAAATGLRSLTCMKHVGLNVASDPLMTLAYIGVRGGMVIVVADDPS
CHSSQNEQDSRYYARLSGLPLLEPATPEEAYQMTRFAFELSEKLELPVLLRTTTRVSHAR
GVVEVGTLPSYDQPIKGKFEKDTHRWVPIPAVARVRHQVLLEKMKEAQRLAESSSWNRTY
GKGPLGIITSSVAANYVEDAFQDLNLFEQIKVLNLGFTHPWPVKLIADFLKQVEKVLVVE
ELEPYLEEAVKVVAQEEGIKVAILGKHTGHLPRYLEFDPGQVKLAIARAFSLDLPKPETP
DISWVPELPPRPPTLCPGCPHRETYNVIKDVLKELGILENTIFPTDIGCYTLGILPPIQM
ADYLICMGSSVGAPCGFSVATDHRIVSFIGDSTFFHAGLSPLASAVFNKHKFTLVVLDNE
TTAMTGHQPVPSQELRPKVLEDRPRIDIEEVVRALGVKNVVTINPYQKEKAKEAVRPILE
KNELSVIIAKAPCVLYRARLAKKK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcatccattaatagaggcgagagccggtcaaaaacttttgttattagggaatgaagct
attgccagaggagccttagaagcgggtcttagagtaggagccgcttatcctgggactcct
tcttctgagataggtaacaatctgtttcagatccagcatgaacttcctggtctttacttc
gaattttctactaatgagaaagtggccatggaagtagcggctgctgcagctgctaccggt
ttaagaagccttacctgtatgaaacatgtagggttgaacgtggcctctgatccgttaatg
acccttgcctatatcggtgtgcgcggtggtatggtcattgtggtggcagatgatccttcc
tgtcactcaagccaaaatgagcaggacagccgctattacgccaggctatcaggccttcct
ttgcttgagccagctacccctgaagaagcctatcagatgacacgctttgcctttgagctt
tcagaaaagcttgagcttcccgtgcttttgcgcactactactagggtttctcacgcgcga
ggggttgtagaagtaggaacactgccttcttatgaccagcctatcaaaggtaagtttgaa
aaagatacacatcgctgggtgcctatccctgcggtagcaagagttaggcaccaggtgctc
cttgagaagatgaaagaagctcaaaggctggcagagtcttcttcctggaatcgtacctac
ggaaaaggtcctctgggtataatcaccagtagtgttgccgccaactatgttgaagacgct
tttcaagacctcaatctctttgaacaaatcaaagtattaaaccttggttttacacaccct
tggccagtcaagctgatagcagacttcttgaagcaagtggaaaaagttttagtggtagaa
gaacttgaaccttatcttgaagaagccgtcaaagtagtggctcaggaagagggtataaag
gttgctatcttaggcaaacataccgggcatcttcccaggtatcttgagtttgatcctggc
caggtcaaactggccatagctagagctttttctcttgacttgcctaagcctgaaacacct
gatatttcctgggtgccggagcttccgccaagacctcccactctttgccctggctgccct
caccgtgagacttacaacgttattaaagatgttttaaaagaactaggcatccttgaaaat
actatctttcctacagatatcggctgttacaccctggggattttgcctcccattcaaatg
gctgattatctcatttgcatgggttcaagtgtaggggctccttgtggtttttctgtagct
actgaccaccgtatagtctcttttataggtgattctacctttttccatgcggggctttca
cccttagccagcgctgttttcaataaacacaaatttactttagttgttcttgataacgag
accacagctatgactggtcatcagccggttccttctcaggaattacgtcccaaagtcctt
gaggaccgtcctagaatagatattgaagaagtagtgagagccttaggagttaagaatgta
gtcactataaacccgtatcaaaaagaaaaggccaaagaggcagtgcgccctatacttgaa
aaaaatgaactttcggtgattattgccaaggccccttgtgtgctttaccgggcccgcttg
gctaagaaaaagtag

DBGET integrated database retrieval system