KEGG   Thermodesulfatator indicus: Thein_0097Help
Entry
Thein_0097        CDS       T01546                                 

Definition
(GenBank) hypothetical protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(94761..94868)
Genome map
AA seq 35 aa AA seqDB search
MAVFRCEKCGATKEGRCKPRKCPKCGEQGTMKKES
NT seq 108 nt NT seq  +upstreamnt  +downstreamnt
atggcggttttccgttgtgaaaagtgtggagccactaaagaaggccgttgtaaaccgcgt
aaatgccctaaatgtggtgaacagggtaccatgaaaaaagaaagctag

DBGET integrated database retrieval system