KEGG   Thermodesulfatator indicus: Thein_0099Help
Entry
Thein_0099        CDS       T01546                                 

Definition
(GenBank) transposase IS116/IS110/IS902 family protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
95629..96882
Genome map
AA seq 417 aa AA seqDB search
MAPEKENNQVLRIIHPICCGLDVHKRFVSACILKTLPDGSIEVEVREFETFTDDLIALRE
WLIEKDCPIVAMESTGVYWQPIHNILEGYVEVILVNARHIKNVPGRKTDVSDSRWLAELL
RVGLLRASYIPPKQVRFWRELVRLRQKHVKTLADYKKRVQKLFESANIKLDNVVSDLFGE
TGRQIMRLLLETPKPSLEEVRACAKGKLKKKVEELYRSICGFFEEHHRFLLHSLLSIIET
LEKEIGIMDIRIKEVMRHHEDLIERLKGIPGVSEVSARAILAEVGPDLRSFPNERALASW
AGVCPGNNESGGKRISGKSPVKKHPLRSVLIEVSWAATRKKGTYYAAKYRQLRARRGPKK
AIGAIAHKILKAVYFIIKEGQEYRELGANHLKQINRERLLTKIKEEAERLGYKVVAA
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggctcctgaaaaagaaaataaccaggttttaagaattattcatcccatttgttgtggc
cttgacgttcataagcgtttcgtctcagcatgtatcctaaagactcttcctgatggttct
atagaagtcgaagttcgagaatttgaaacttttaccgacgatcttatagccctgagagaa
tggctgatcgaaaaagattgtcccattgtagccatggaaagcacaggtgtttactggcag
cctatacacaatattttagaaggctatgtggaagtgatcttagtcaatgccaggcatatc
aaaaatgtccctggacgaaagacggatgtctcagacagccgctggttagcagaattactt
cgtgtaggtctgctacgggcaagttatattcccccaaaacaagttcgtttctggagagag
ctagtacgacttagacagaaacatgtcaaaacgcttgctgattataagaaaagagttcaa
aagctttttgaatcagcaaatattaagctagacaatgtagtttcagatttgtttggggaa
acaggtcgtcaaatcatgagattacttttagagacccccaagcctagccttgaagaagtt
agggcttgtgctaaagggaaacttaagaagaaagtagaagagctctatcgctctatttgt
ggctttttcgaagagcatcatcgttttcttttgcattcgctcttaagtataatagagact
ctggaaaaagagatagggattatggatataaggatcaaggaagtaatgagacaccatgaa
gatttaatagagagattaaaagggataccaggagtaagtgaagtttcagcgcgagctatt
ttggcagaagtagggccggatctgagaagttttccaaatgagagggcgctagccagttgg
gcaggagtttgtccagggaataacgaaagtggaggaaagaggattagcggcaagagcccg
gtaaagaaacatcctttaagaagcgttttgatagaggtgtcttgggcggccacgaggaag
aaagggacatattatgcggcaaaatataggcaacttcgtgctcgtcgagggcctaagaaa
gccataggggccatagcgcataagatattgaaagcggtgtattttatcatcaaagagggt
caggaatacagggaattaggggcaaatcatctgaagcagataaatagggagagattattg
acaaaaataaaagaagaagcagaaagacttgggtataaagtggtagcggcataa

DBGET integrated database retrieval system