KEGG   Thermodesulfatator indicus: Thein_0105Help
Entry
Thein_0105        CDS       T01546                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K07023  
putative hydrolases of HD superfamily
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(103036..103608)
Genome map
AA seq 190 aa AA seqDB search
MFWHRLAKLLFEGAMLKRLERTGYAYLGTGKENIAAHSFGVSLAAMMLAKLVPEVDETKL
LKMAILHDFLEARTGDLNSVNKLYDRVDEEAAANDAFSGLPWEEEWQELLREYREAKTLE
AQLVHDADQLDLMVMLKEQHDLGNPYARRWLVYAKRRLRTDIGRKLAEAITETDWASWWL
DQFVAKDETN
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttttggcacaggttagccaagctcctctttgaaggagctatgttgaaacgccttgaa
cgcacgggatatgcctatttggggacaggcaaagagaacatagcggcccattcctttggt
gtttccttggccgctatgatgcttgccaagctcgttccagaagttgacgaaactaaactg
cttaagatggccattttgcatgattttttagaggcacgcaccggggacctcaattcggta
aacaaactctatgacagagttgacgaagaggccgcggctaacgatgccttctctggtctt
ccttgggaggaagaatggcaggagcttttaagagaataccgcgaggccaagacccttgag
gcccaactagtccatgatgccgaccagctagacctcatggttatgctcaaggagcagcat
gacctgggaaacccttacgcccgccgctggctggtttacgccaaaagaaggcttcgtacc
gatattggccgtaaacttgcagaggccattaccgaaacagattgggcctcctggtggctt
gaccaatttgtggccaaagatgaaaccaactga

DBGET integrated database retrieval system