KEGG   Thermodesulfatator indicus: Thein_0122Help
Entry
Thein_0122        CDS       T01546                                 

Definition
(GenBank) heat shock protein DnaJ domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ
Motif
Other DBs
NCBI-ProteinID: AEH44007
UniProt: F8A8W0
Position
complement(121120..122121)
Genome map
AA seq 333 aa AA seqDB search
MYLARQKRGKYTYFFLRESYFADGLWRSRDLIALGRDPSRFIVYPGGNSFYIKEEIIESL
AEKGVKTDQWELEKIFWPFVDPHIRRVIENFSAHQVVKRNRLSAREQLALQQKYHIFDCR
RLLFLKFGGTEVDFLLKRPLGFLNVLYQKSRDEIEQYIMVAEEKLRPRETLAYIYTSFGL
AKHFPNRLSRYMPEAQAMEKIDEAFLCELCLLLEDEKYLMGLEPNQVLKEYLSRYVIMYF
DRLAQERRFFEEREARLLEKRRADLYHVAHEAAGLFGLSPEKIIRLNKDELSTLFRRKAR
ELHPDQGGEHEAFIKLRKLYEELMKLQGYQRLI
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtacttagcgcggcaaaaaagaggaaaatacacttatttttttctgcgagaatcatat
tttgctgatgggctttggcgaagtcgtgatttaatagctttaggaagagatccttctcgt
tttattgtctatcctggtggcaatagcttttatattaaagaagaaataatcgaaagcctt
gcggaaaaaggagttaaaactgaccagtgggaactagaaaagatattttggccttttgta
gatcctcatatccgccgcgtaatagaaaatttttcggcgcaccaggttgttaaaagaaat
cgtctttctgctcgtgaacaattagcacttcagcagaaataccacatatttgattgtcgg
aggcttctttttttaaaatttggcggaactgaagttgatttcttattaaagcggcctctc
ggctttttaaatgttctttatcagaaaagtcgagacgaaatagaacaatacatcatggtt
gctgaagaaaaattgcgtcctcgggagacattagcctatatttacacatcttttggtcta
gccaagcactttcccaatcgtttaagccgttatatgcctgaggcccaagcaatggaaaag
atagatgaggcctttctttgtgaattatgtcttttgctggaagacgaaaagtaccttatg
gggcttgagccaaaccaggtattaaaagaatatctttcccgttacgtgattatgtatttt
gatcggttagctcaagaacgccgcttttttgaagaacgtgaagccagactactcgaaaaa
cgtcgggctgacttatatcatgtagcccatgaagccgcaggcctatttggcctttcgcct
gaaaaaattattcgcttaaataaagacgaactttcaactctctttaggcgtaaagcaaga
gagctacaccccgaccaagggggtgagcacgaagcctttattaaactgcgcaagctttat
gaagaacttatgaaactacaaggttatcagagacttatctaa

DBGET integrated database retrieval system