KEGG   Thermodesulfatator indicus: Thein_0133Help
Entry
Thein_0133        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF343
  KO
K09791  uncharacterized protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trm112p TF_Zn_Ribbon zf-C4_Topoisom Anti-TRAP PADR1 zf-TFIIB
Motif
Other DBs
NCBI-ProteinID: AEH44018
UniProt: F8A8X1
Position
complement(132197..132415)
Genome map
AA seq 72 aa AA seqDB search
MFGGLFVSLIPQELLAVLACPKCKGDLTVDESRQGLVCYKCSLLYEVRDGIPIMLEEEAQ
KIDLKNENKKDE
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcgggctttttgtaagccttataccgcaggaactcttggcggtactggcttgt
cctaaatgtaaaggagaccttacggttgatgaatcacgtcaagggcttgtttgctataaa
tgttccttgctttacgaagtaagagacggtattcctatcatgctcgaagaggaagcccag
aaaatagaccttaaaaacgaaaacaaaaaagatgagtga

DBGET integrated database retrieval system