KEGG   Thermodesulfatator indicus: Thein_0136Help
Entry
Thein_0136        CDS       T01546                                 

Definition
(GenBank) efflux transporter, RND family, MFP subunit
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 Biotin_lipoyl DUF2605 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AEH44021
UniProt: F8A8X4
Position
complement(136027..137139)
Genome map
AA seq 370 aa AA seqDB search
MNKLKPFLILLVVFLLIFGAFRVVKLKKETIQSVKPPQKIPLPVEVAKVTKGTLEIREHY
LGTITPVHEANIATRISGYILRITKYEGDKVKKGELLVEIEAKDIEAKLGVLKTQLASAQ
TELLVRKGIFERNQKLLEHEAISQEAFDLSKAAYQAALARVEQLKQEIEAAKVNLSYAFI
KAPFSGVVTRRFKNPGDMATPGAPLITLEDPKAGYRLLVNIPQEKAASIVPGDRVYISLG
DRQKIAAVYKVYPAVSKEALATVEIRLKKRPFSLPSGASLGVDLVLANLEGLLLPAKALV
PGKSQGVYVVEKGRLKFIPVRVLGQSKGQVVASGKLNEGDQVVVGDPGLLLRLYPGQKVI
PIKGGHDESI
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaataagcttaaaccttttctaatattgttggtggtttttcttttgattttcggggct
tttagagtggtcaaactcaaaaaagagactatccaaagtgttaaaccgccccagaaaatc
cctttacccgttgaagtagcgaaggtaactaagggtacgcttgaaatacgtgaacattat
ctgggaactatcacccctgtgcacgaggctaacatcgccaccaggatatctggctacatt
ttaaggattaccaaatatgaaggggataaggttaaaaagggagaacttttggttgagata
gaggccaaggatattgaagccaagctcggcgttcttaaaacacaattggcctcggctcaa
acagaacttttagtgcgtaagggtatttttgaacgcaaccaaaagcttcttgagcatgaa
gctatttcccaggaggcctttgacctttctaaagctgcctatcaagccgctctcgcaagg
gtagaacagcttaagcaggaaatagaagcggctaaagttaatctttcttatgcctttatt
aaggctcccttctctggagtagttaccaggcgttttaaaaatccaggtgacatggctacc
cctggagctccccttataactcttgaagatcctaaagcaggttatcgtcttttggtaaac
ataccccaggagaaggcggcctcaatcgttcctggtgacagggtctatatttcgcttggg
gacaggcaaaaaatcgccgcggtttataaggtttatccagcggtctctaaagaagccctg
gctaccgtggagataaggctaaagaagaggcctttttccctgccaagcggggcctcttta
ggagtggatctggttttggccaatcttgaagggcttctcttgccggccaaagccctggtg
cctggcaagtcccagggagtttacgtggtagaaaaaggcaggcttaagttcatccctgta
agggttcttggccagagcaaaggccaggtggttgcctcaggaaagcttaatgaaggcgat
caggtagtagtgggagatccagggctgcttctaagactttaccctggccaaaaagttatt
ccaattaaaggaggccacgatgaaagtatttaa

DBGET integrated database retrieval system