KEGG   Thermodesulfatator indicus: Thein_0139Help
Entry
Thein_0139        CDS       T01546                                 

Definition
(GenBank) Tetratricopeptide TPR_1 repeat-containing protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_2 TPR_14 TPR_19 TPR_1 TPR_8 TPR_6 TPR_10 TPR_12 TPR_11 TPR_16 DUF3808 ANAPC3 TPR_7 DUF1347 DUF2225
Motif
Other DBs
NCBI-ProteinID: AEH44024
UniProt: F8A8X7
Position
complement(139230..139838)
Genome map
AA seq 202 aa AA seqDB search
MKKVLFTLVLTFFLMGSSALALNVQQAFRDSYRYEKMASYQDAIDALLPVYQKYPKFYLV
NLRLGWLYYLAGKYRNSIDYYEKALSIKPSSFEALLGLSLPYMAQKNWPKVEELMRRLIR
EDTYNYYGNLRLAIALRLQNKADHAERVMRKMLQRYPTSVLFLVELGQDLWWQGKQNEAR
RVFRQVLLLSPENIVAKNYLKK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttctatttactctcgttttaaccttttttctgatgggctcttcggcttta
gctttaaatgttcagcaggcttttcgtgattcatatcgctacgaaaaaatggcctcttat
caagatgctattgatgctcttttgcctgtatatcaaaaatatccaaaattttatctggtt
aatttgagactaggatggctttattatctggctgggaaatatcgaaattcaattgattac
tatgaaaaggctttaagcataaaaccaagttcttttgaagctcttttaggattatcattg
ccatatatggctcagaaaaactggcctaaagtagaagagcttatgagaaggctaataaga
gaagatacatataattattacggaaatttgcgattagccatagctttgcgtcttcaaaac
aaggcggatcacgctgagcgagtaatgcgaaaaatgttgcagcgctatcctactagcgtt
ttatttttagtagaacttggccaggatttatggtggcaagggaaacaaaacgaagccagg
cgtgtttttcgtcaggttcttcttttgtctccagaaaacatagtggccaaaaactattta
aagaaataa

DBGET integrated database retrieval system