KEGG   Thermodesulfatator indicus: Thein_0147Help
Entry
Thein_0147        CDS       T01546                                 

Definition
(GenBank) Ppx/GppA phosphatase
  KO
K01524  
exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
tid  Thermodesulfatator indicus
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Thein_0147
Enzymes [BR:tid01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     Thein_0147
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     Thein_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
148555..149769
Genome map
AA seq 404 aa AA seqDB search
MNKSDLVDILWREFPEFRRRDLELIVNLLFERLTQALKDEERIEIRGFGRFIVKRQKERF
FKNPRTGEEQIIPTRKRVIFKVGKDLKERLNQHALASIDLGTQTFRLLIGKASEGDFKIL
LKERFNVRLGEKLTKEGRISEKAHERGIKALKKIRLLLDKAEVKEVFAAGTEVFRKAQNA
DYFLEQAQKILGTPVKILSPEEEALYTAKGVLFSLKPESSPVLIIDVGGGSTEYILCHHE
KPIKIGSLKLGAVTLKEKFFPSDDIPTSKEMEEAKNEITNFLEEIKYLSPAPHSLIATGG
TATCLAALAQGLERYSPAKVHGYFLKTEKLKELVQKLASLSSSEIKFLKGMEEGREDIIL
PGALIYSALADILNSKGFLISETGILEGLLLHLIEKRPIISENI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaagcgacttagtagatatactttggcgagaatttcccgaatttagacgccga
gaccttgaacttattgtaaacctcctttttgaaagattaactcaggccttaaaagacgaa
gaacgcatcgaaatacgcgggtttggaagatttattgttaaacgacaaaaagagcgcttt
tttaaaaatcccagaacaggcgaagaacagatcattcctactcgtaaaagagttattttt
aaggttggtaaagaccttaaagaaagacttaatcaacatgctttggcaagcattgatctg
ggcacccaaactttcagattacttattggcaaagcctctgaaggcgattttaaaatcctt
ttaaaagaacgttttaacgtacgcctaggcgaaaagctgactaaagaagggcgaatttca
gaaaaggctcatgaaagaggaattaaagcccttaaaaaaatacgcctattgcttgataaa
gccgaggtaaaagaagtttttgccgctggcaccgaagtttttcgcaaagcccaaaatgct
gactattttttagaacaggcccaaaaaattttaggtacacctgtaaaaattctaagtcca
gaggaagaagccctttatacggctaaaggcgttctttttagccttaaaccagaaagttcc
cctgttctcattatagatgtaggagggggtagcactgaatacattctttgccatcatgaa
aagcctataaaaattggaagcctcaaattaggtgccgtaaccctaaaagaaaagtttttc
ccttctgatgacatccccacttcaaaagaaatggaagaggctaaaaatgaaattacgaac
tttcttgaggaaataaagtatttgtcaccagcacctcattctttgattgctacgggaggc
acagcaacttgtttagccgctcttgcccaggggcttgaacgttactcacctgctaaagta
cacggttattttttaaaaactgaaaaactaaaagaacttgtacaaaaactggccagtctt
tcttcatctgaaataaagtttttaaaaggcatggaagaaggccgggaagatataatttta
cctggagcattaatttattcggctttagcggatattttaaatagcaaaggttttttaata
agtgaaacaggaattctcgaagggttgctcttgcatcttatagaaaaaagacccattatt
tctgaaaatatttaa

DBGET integrated database retrieval system