KEGG   Thermodesulfatator indicus: Thein_0151Help
Entry
Thein_0151        CDS       T01546                                 

Definition
(GenBank) chaperone DnaJ domain protein
  KO
K05516  
curved DNA-binding protein
Organism
tid  Thermodesulfatator indicus
Brite
Chaperones and folding catalysts [BR:tid03110]
 Heat shock proteins
  HSP40 / DNAJ
   Thein_0151
Chromosome [BR:tid03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    Thein_0151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(153301..154275)
Genome map
AA seq 324 aa AA seqDB search
MAKDYYKILGVSRNATQEEIKKAYRRLALKYHPDRNKGNKEAEERFKEINEAYAVLSDPE
KRRQYDQFGSTEFHRRYTQEDIFRDFDFESIFRDLGVGFDLGSFFGFGGKRRGSTSFRID
LGDLFSQVFGTSPEEEWFGKESYRTKHAERDFVSNGDVVLELPVTLEEVAQGAEKIISIA
PTGKAERIKVKIPQGVEDGQKLRIPAQGTYGPHGRRGDLYLKVKIEEHPIFERDGKNIIC
DHEIKFSEAVLGTTIEVPTLYGKKVRVKVPPGTRSGAKLRLRGLGLPDKSGGKGDQFVRI
NIKVPKTLTKEQKDLIKKLAKEGL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagattactacaagattttaggggtttcgcgaaacgctacccaagaagagata
aaaaaggcttatcgtcgcctggctcttaaatatcatcctgaccgcaataaaggtaataaa
gaagctgaagaacgttttaaagaaataaatgaggcctatgccgtcctttccgatccagaa
aaacgccgtcaatatgatcaattcggttctacagaatttcaccgtcgttatacgcaagaa
gatatttttcgagattttgattttgaatctatttttcgtgatttaggagttggttttgac
ttgggtagtttttttggttttggaggaaagcgacggggtagtactagtttccgaatagat
cttggtgatctttttagtcaagtatttggaacgtctccagaagaagaatggtttggcaaa
gaatcataccgcaccaaacatgctgaaagagattttgtttcgaatggggacgttgtttta
gaactcccggtaacccttgaagaagtggcccagggagcggaaaagataatatctatcgcc
ccaactggtaaagccgaacgtattaaagtcaaaattcctcaaggtgtagaagacggccag
aaattgcgtattcccgctcagggaacctacggtcctcacgggcgacgaggggatctttat
ctcaaagtcaagattgaagagcatcccatttttgaacgtgatggtaaaaatattatctgt
gaccatgaaataaagttctctgaggccgttttaggtactactattgaagtccccactcta
tacggaaaaaaggtaagggtaaaagtgcccccgggcacgaggagtggggccaaactgaga
ctaagaggccttggtcttcccgataaatctggtggtaaaggggaccagtttgtcaggata
aacattaaagttcctaaaactttaactaaagaacaaaaggatttgattaagaaacttgcc
aaagaagggctttaa

DBGET integrated database retrieval system