KEGG   Thermodesulfatator indicus: Thein_0153Help
Entry
Thein_0153        CDS       T01546                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_0153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_0153
   00620 Pyruvate metabolism
    Thein_0153
   00640 Propanoate metabolism
    Thein_0153
  Energy metabolism
   00680 Methane metabolism
    Thein_0153
Enzymes [BR:tid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thein_0153
Lipid biosynthesis proteins [BR:tid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thein_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
156132..158039
Genome map
AA seq 635 aa AA seqDB search
MSNAHNYDTQIDHLLKSTERFSPPTKVLEEAFIKDYDSVYAYSIRDPEGFWGQIASELAW
FEPWQKVREINLPYHRWFVGGKTNITLNALDRHADSWRRNKVAVIWLSEEGEEQVGTYGQ
LRDRVNQFANGLKSLGVGKGDRVVIYMPLTIEGVIAMLACARIGAIHSVVYAGMGAGALR
SRIEDCQAKIVICSDVTFRRGKVVRLKAVVDEALETLDFVEKVIVHRRTSPPIELEEWEV
DFWELLKSHSHRCQAEVMDAEDPLFILYTSGTTGKPKGVVHVHGGYMVGTYYLSRAFFDL
KDQDVYWCTSDIGWIVGHSFIVYGPLCAGATILIREGAPDYPHPGVIWEMVQKYGVSVMF
TAPTALRMFMRFGKEHIEKYDRSTLRILACAGEPLNPEAWRFAQEIILENQGYCIDNFWQ
TEVAGPVLGTLPCLSAKPGFAGKPLPGVLADVVDAEGRSLPAGKGGYLVLRQPLPYMMRT
IYNDPARYESYWKEIPGCYKTGDIAVCDEEGYFAVLGRADDVLNVAGHRIGTADLESALV
SHPAIAEAAAIGLPDEVKGERIKVFVVLREGKKPSDGLRKSIIKHVRKELGPIATPSEVV
FVDKLPKTRSGKIMRRLLRARELGLPEGDTSTLED
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacgcccacaattatgacacacaaattgatcatcttctaaaaagtactgaaaga
ttttctccccctactaaagttttagaagaggcttttataaaagattacgactctgtttat
gcctactcaattagagatccagagggcttttgggggcaaattgcctcagagcttgcctgg
tttgaaccatggcaaaaggtaagagagataaatctaccctaccatcgctggtttgtaggc
ggaaaaacaaacatcaccttaaacgcccttgaccgccatgctgattcctggaggcgcaat
aaagtagccgtaatctggctttctgaagagggagaagaacaagtcggcacatacggccag
cttagagacagagttaaccagtttgctaatggactcaaatcattaggtgtcggcaaaggt
gatcgggtagtcatttacatgcctttaaccattgaaggtgttatcgctatgctagcctgt
gctcgtatcggggccattcactcggtagtttacgccggcatgggagccggagccctgcgt
tctcgtattgaagattgtcaggctaagattgtgatatgttctgacgtgactttcagacgt
ggcaaggtggtaagacttaaagccgtagttgacgaagcccttgaaacactagactttgtc
gaaaaagtaatagtccaccgtcgcacaagcccacccattgagctggaagaatgggaagtt
gacttctgggaacttttaaaaagtcattcccatcgttgccaagctgaagtcatggatgcc
gaagatccattatttatactttatacttcgggaacaaccgggaaacctaaaggcgtggtc
catgttcatggtggatatatggtaggcacttattatctttccagagcctttttcgattta
aaagaccaagatgtctattggtgcacatctgatataggctggatagtagggcattctttt
attgtttacggaccactctgtgccggggctactattctcattcgcgaaggagcccctgac
tatccccatccgggcgttatctgggagatggtacaaaaatacggtgtctccgtaatgttt
accgcccccaccgctctccgtatgtttatgcgctttggcaaggaacacattgaaaaatat
gataggtcaaccttaagaattctagcctgtgccggagaacccctgaatcctgaagcctgg
cgctttgctcaggaaataatccttgaaaatcaaggttattgtatagataatttctggcaa
actgaggtagctgggcctgttttaggtacccttccctgtctttcagctaaaccaggcttt
gcgggaaaacctttgcctggagtgctggctgacgtggttgatgccgagggacgttctctc
ccagcaggtaaaggcggatatctcgttctgagacaacctctgccttacatgatgcgcact
atttataatgacccggccagatatgaatcttactggaaagaaattcccggttgctacaaa
actggagatattgctgtttgcgatgaggaaggctatttcgccgtgttaggaagggcagac
gacgtactaaacgtagctggtcaccgtattgggacggcagaccttgaatcagccctggtt
agtcatccagccattgccgaagctgcggccattggacttccagatgaagtaaaaggggaa
cgcatcaaagtctttgtagttttgagagaagggaaaaagccctctgatggcttgagaaaa
agcatcatcaaacacgtacgcaaagaattagggcctattgctacaccttctgaggtggtt
tttgttgataaactcccaaaaacgagaagtggaaagataatgcgtcgcttattacgggct
cgagagttagggcttcctgaaggagatacctctacccttgaagattaa

DBGET integrated database retrieval system