KEGG   Thermodesulfatator indicus: Thein_0154Help
Entry
Thein_0154        CDS       T01546                                 

Definition
(GenBank) Phenylacetate--CoA ligase
  KO
K01912  
phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
tid  Thermodesulfatator indicus
Pathway
Phenylalanine metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Thein_0154
Enzymes [BR:tid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     Thein_0154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
158246..159553
Genome map
AA seq 435 aa AA seqDB search
MDRHKKDFLPREDLEAIQLKRLKETVERVYHLVPFYRQKFDEVGLKPKHIKSLDDLKNLP
FTTKQDLRDHYPFGLFAAPLDQIIRIHSSSGTTGKPTVVGYTENDLKVWTEVMYRTFKMA
GVGPGDVVHNAYGYGLFTGGLGFHYGAEAVGAAVVPSSVGFTKRQLMLLKDFGATILCST
PSYALHLAEVAKEEGYDPPKDFLLRAGFFGAEPASEGLRQAVAEAWGIKYFECYGLSEII
GPGVAASCPEGELHIFEDHFIPEIINPETGEVLPEGEEGELVFTTVSKQGLPIIRYRTKD
IASLYKAPCKCGRTILRMGRILGRTDDMLIVSGVNVFPSQVEHVLTQVEGLTPNYVIVVD
KRGVLDVLEVWVEVDERVFTGDIGSLENLKRKLEEELANALFLRARVKLVEPKTLERSMG
KAKRVVDRRELKDIA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggatcggcataaaaaagactttttaccccgtgaggatttggaagctatccaactcaag
cgcttaaaagaaactgttgagagggtatatcatctggttcctttttatcgtcaaaagttt
gacgaagtcggcctaaaacccaaacacataaagagtcttgatgatctcaaaaatcttccc
ttcaccaccaagcaggacttgagagatcactatccctttgggttatttgctgctccttta
gaccagatcataagaatccattcttcttcaggcactacgggcaaaccaaccgtggtggga
tatacggaaaatgacctgaaagtctggactgaggttatgtatcgcacttttaaaatggcc
ggtgtcggcccgggggatgtggttcataatgcttatggttatggcctttttaccggtggt
cttggctttcattatggagcagaagccgtaggcgccgcggtagttccctcaagtgttggc
tttaccaaaagacagcttatgcttcttaaagactttggagccactatactttgttctact
ccttcttacgctttgcacctggccgaggttgctaaagaagaaggatatgatcccccaaaa
gattttcttttaagggcaggtttcttcggcgctgaaccagcctctgaagggcttcgccaa
gcagtggctgaagcctgggggataaaatactttgagtgttacggactttctgaaattatc
ggcccaggggtggccgcaagctgccctgaaggagagctgcacatatttgaagaccacttt
atcccggagataataaatcctgaaaccggagaagtactccccgaaggagaagaaggcgaa
ctcgtgtttacaactgtttccaaacaagggcttcctataattcgttatcgcactaaagac
atagcaagcctttacaaggccccgtgtaagtgcggacgcaccattttgcgaatgggccgt
attcttggccgaacagacgatatgctcattgtttcaggggttaacgtctttccctcacag
gtggagcatgtgctcacacaggtggaaggccttacccctaactacgtaatcgtagttgac
aaacgcggtgtattggatgtgcttgaagtctgggtagaagtagatgaaagggttttcact
ggagatattggttcgctagagaacctaaaacgcaagcttgaggaagaactggccaacgct
ttattcttgagggccagagttaaactcgttgagccaaagacccttgagcgttctatgggg
aaggccaaacgagtggttgaccgccgcgaacttaaagacatagcttaa

DBGET integrated database retrieval system