KEGG   Thermodesulfatator indicus: Thein_0155Help
Entry
Thein_0155        CDS       T01546                                 

Definition
(GenBank) amino acid-binding ACT domain protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT ACT_4 ACT_6 ACT_7
Motif
Other DBs
NCBI-ProteinID: AEH44040
UniProt: F8A8Z1
Position
159566..160012
Genome map
AA seq 148 aa AA seqDB search
MRGKYAIKQLSIFLENRKGRLKEVTRVLAEANVNIRALALAESAEFGILRLVVDNPEKAR
SVLSSEGFTVKEQEVFAVEVPDKPGGFYQVVKALTEADINIDYTYAFVGGKDSAILIFKV
PDHLFEKALEVVHKEGIKLVEPIFFYGK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtaaatacgctataaaacagctatccatttttcttgaaaatcgtaaaggacgt
ttaaaggaagttaccagggtgctggccgaggccaatgtgaacataagggctctggccctg
gctgaaagtgcggagttcggtatccttcgcctggtagtggataatccggaaaaggctcgc
tccgtcctttcttcagaaggctttaccgttaaagaacaggaagtctttgccgtagaagtc
cccgataagccaggaggtttttaccaagtggttaaagccctcactgaggccgacataaac
attgattacacctacgcctttgtgggtggaaaagactcggccattcttatctttaaagtg
cccgaccatctctttgaaaaggcactagaagtagtccataaagaaggtataaaactggta
gaacctattttcttttacgggaaataa

DBGET integrated database retrieval system