KEGG   Thermodesulfatator indicus: Thein_0159Help
Entry
Thein_0159        CDS       T01546                                 

Definition
(GenBank) heat repeat-containing PBS lyase
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
163913..164992
Genome map
AA seq 359 aa AA seqDB search
MLKAKPVLCPFCGHPVAPPQNLGFQFSDFDAGFCDCGAVYVSDVTGHNRGAAFVEALLLA
CGGNWDLAWELEPEADYQEQVVEHYDQKSHQVFGDPSDRVNVKGVLIFLRLSDELRDLSA
EKIAEIKASRRTKESPPPGFKPKRLRRQEIEKLLHENREKEIVYHCRFLPVNLSTLRKVL
YSADPLLRWRAVVTMGEAAQAVLKTRPDITADLIKRLIYSSADSAASAWGALETVGEIIR
REPGRFSLFVKNLLAFLKYPEFRSGALWALYRIAQGKPSLIKNERYWIILDLLKDQEPIV
RALATMVCQYARIIEALPALKNLLEDQDIVEIFNPEEKNFKKVTVGALAKEAIKTLERT
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaagctaaaccagttctttgccctttttgtggacacccggtggctccacctcaa
aacctcgggtttcaattttctgactttgacgccggcttttgtgactgcggagcggtttat
gtaagcgatgttaccggacataaccggggagcagcctttgtagaggctcttcttttagct
tgtggcggtaactgggacctagcctgggaacttgaacctgaagcagactaccaggaacag
gttgttgagcattatgaccaaaaaagtcaccaggtttttggagatccttctgaccgcgta
aatgtaaaaggggttcttattttcttacgtttatcggatgaattgagagatctttcggca
gaaaagatagccgagattaaagcctctcggcgaactaaagaatctccaccgccgggcttt
aaacctaaaagattgcgccgacaagagatagaaaaactattgcatgaaaatagagaaaag
gaaattgtttatcattgtcgctttttgccagttaaccttagcactttgcgtaaagttctt
tatagtgcagacccccttttacgctggagggctgttgttactatgggagaagcggctcag
gccgtacttaaaactagacctgatataaccgccgatttaataaaaaggcttatctactct
agcgcagattcagccgcttcggcctggggagcccttgaaactgttggtgaaataataaga
cgtgagcctgggcgttttagcctttttgttaaaaatctcttagcttttctcaaatatcca
gagtttagatcaggagctctttgggccctttatcgtatcgcccaggggaaaccttctttg
atcaaaaatgaacgctactggatcattttggatttattaaaagatcaagaacctatagta
agggccttagccactatggtatgtcagtatgcgaggataatagaggcgttacctgcctta
aaaaacctgttagaagatcaggatatcgtggaaatctttaatcctgaagaaaaaaatttt
aaaaaggtaactgttggcgctctagctaaagaagctattaaaaccttagaaaggacttaa

DBGET integrated database retrieval system