KEGG   Thermodesulfatator indicus: Thein_0165Help
Entry
Thein_0165        CDS       T01546                                 

Definition
(GenBank) regulatory protein MerR
  KO
K13640  MerR family transcriptional regulator, heat shock protein HspR
Organism
tid  Thermodesulfatator indicus
Brite
Transcription factors [BR:tid03000]
 Prokaryotic Type
  Helix-turn-helix
   MerR family
    Thein_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MerR_2 MerR_1 HTH_17 MerR Exc DUF1192 HTH_Tnp_1
Motif
Other DBs
NCBI-ProteinID: AEH44050
UniProt: F8A901
Position
169728..170030
Genome map
AA seq 100 aa AA seqDB search
MAIYYEMKIICEKVGLTPKTLRVWMEEGLISPRREGRRYLFDEEDLKRLLLIRRLRDDLG
VNLAGIDIILQLLDRVQELEKEIERLKGALGEGCPPRLIS
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggcgatatattatgaaatgaagattatttgcgaaaaagtaggcttaacccctaaaacc
ttgcgcgtgtggatggaagaagggcttatttcgccacgccgtgaaggcaggcgctaccta
tttgacgaagaagacctaaagcgcctccttctaataagacgcctaagagatgatttagga
gtaaacttggctggcattgacattattttgcaattattagacagagtccaagaactagaa
aaagagattgagcgtcttaaaggcgctttgggagaaggttgtcctccaaggcttataagc
taa

DBGET integrated database retrieval system