KEGG   Thermodesulfatator indicus: Thein_0167Help
Entry
Thein_0167        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF101
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
172240..172659
Genome map
AA seq 139 aa AA seqDB search
MNPGYETFEHGADIGVRGIGKTLEEAFINAAKALFSLVVINLEEVRPEREVSFEISADTL
EDLFVEWLNRLLTEAGMENLVFCQFDCKIENLNLKGQAKGEPIDEERHELGVEVKGATYT
MLKVERVNDLWIAQCVVDV
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaggatacgaaacctttgaacacggagctgatattggcgtgcgcggcatcggc
aagaccctggaagaagcctttatcaatgcggccaaggccttatttagcctggtagttata
aatcttgaagaggtaagacccgagcgagaggtttcctttgaaatttcggcggacacctta
gaagaccttttcgtggaatggcttaatcgtctccttaccgaagccggcatggaaaacttg
gttttctgccagtttgactgtaaaatagaaaatttaaacctcaagggacaggccaaaggc
gaacccatagacgaagaacgccacgaattaggcgtggaagtcaaaggcgctacctacacc
atgttaaaggttgaaagagtaaacgatctctggatagcccagtgtgtagtggacgtgtaa

DBGET integrated database retrieval system