KEGG   Thermodesulfatator indicus: Thein_0259Help
Entry
Thein_0259        CDS       T01546                                 

Definition
glycoside hydrolase family 3 domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tid  Thermodesulfatator indicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_0259
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Thein_0259
Enzymes [BR:tid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Thein_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(272121..273080)
Genome map
AA seq 319 aa AA seqDB search
MQKIGKLFIVGLEGDSLSAEELEAIKALKLSHFIFFKRNLVSKEQIESLLTKLNEKTGLG
LRAVDQEGGPVVRLLPPLFPQLPSLYALAQREKPAEEVRNTAKLCAQNLKELGFNFNLAP
VLDLADDKAPSFIRERSFDKESSLVAELGTIYIKTFIEEGLLCCAKHFPGLGGVDLDPHH
SLPEKPEVTKDDLYPFVKAFEAGVPAVMTTHLVVKNIDDKPATFSPKIINMLRRELDFRG
LVLTDDLYMKGAAISSFEERVLRAFISGHDLLLLCEDFWQSVIVIENFIKEAEHSYSLKE
LIAESLGRQNKVLNSFLPS
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaataggtaaactttttatcgttggccttgaaggagattctctgagtgccgaa
gaactggaagccatcaaagctttaaagctttcccattttattttttttaaacggaatctt
gtttctaaagagcaaatagaaagtcttttgacaaaacttaatgaaaaaacaggcctgggt
ttaagggctgttgaccaagaaggcgggcctgtagtaaggcttttgcctccgctttttccg
caattgccttctctatatgcgctagcccagagagaaaaacctgccgaggaggtgagaaac
accgctaaactttgtgctcaaaatctaaaggaactgggctttaatttcaatcttgctccg
gtgctcgatctggctgatgataaagccccttcttttattcgcgaacgctcttttgacaaa
gaaagctcccttgtggctgaactcggaactatttacataaaaacttttattgaagaaggt
cttctttgttgtgccaaacattttcccggcttgggaggtgttgatcttgatccccaccac
agtcttcctgaaaaaccagaagttactaaagatgatctttatccttttgttaaagccttc
gaagctggcgtgcccgcggtgatgactactcatttggtcgtcaaaaacattgatgataag
ccggccactttttctccaaaaataataaatatgttacgcagagagttagattttcgcggg
cttgttttaacagatgatctttacatgaaaggagcggctatctcttcttttgaagaaagg
gttcttagggcttttatttctggacatgacttattactcctttgtgaggatttttggcaa
tcagttatagttattgaaaattttattaaagaggcagaacatagctattcgttaaaagaa
ttaattgccgagtctttggggcggcaaaacaaggttttaaactcgttcttgcctagttag

DBGET integrated database retrieval system