KEGG   Thermodesulfatator indicus: Thein_0380Help
Entry
Thein_0380        CDS       T01546                                 

Definition
RpiB/LacA/LacB family sugar-phosphate isomerase (EC:5.3.1.26)
Orthology
K01808  
ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
tid  Thermodesulfatator indicus
Pathway
Pentose phosphate pathway
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:tid01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tid01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tid00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tid00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
402334..402774
Genome map
AA seq 146 aa AA seqDB search
MKIAIGSDHAGFELKEKIKAFLEDFGHNVLDLGCYSKESVDYPEFGVKVAQAVLNKEAER
GILICGTGLGMSMVANRFRGIRAALCHELFTTKMARLHNDANVLVLGGRVIGEALALEMV
KVFIDTPFGGGRHERRIKLIDELTKE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagctatcggaagcgaccacgctggctttgaactaaaagaaaagattaaggcc
tttctggaagactttggccataatgtattagaccttggctgttattcaaaagaatctgtt
gattacccggaatttggagtaaaagtagcgcaagcggtgttaaacaaagaggccgagcgc
ggaatccttatttgcggaactggccttggcatgagcatggtggctaatcgcttccgcggc
attagggcggctctttgccacgaacttttcaccaccaaaatggcccgtcttcacaacgac
gctaatgttttagttctgggtggccgggtaattggtgaagccctggcccttgaaatggta
aaagttttcattgataccccttttggaggcggccgccacgaaagaagaatcaagcttata
gatgaattgaccaaggagtaa

DBGET integrated database retrieval system