KEGG   Thermodesulfatator indicus: Thein_0522Help
Entry
Thein_0522        CDS       T01546                                 

Definition
glutamyl-tRNA(Gln) amidotransferase subunit A
Orthology
K02433  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
tid  Thermodesulfatator indicus
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Thein_0522
Enzymes [BR:tid01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Thein_0522
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Thein_0522
Mitochondrial biogenesis [BR:tid03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Thein_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(550075..551529)
Genome map
AA seq 484 aa AA seqDB search
MEWHKLSLNEQLENLRQGKVSSVELTKALLDYIEKKDPQVKAFLKITREEALSQAQEADK
LRQKGEDKPLLGVPIAIKDNICTRGITTTCASKMLENFVPPFDATVITKLKEAGAVILGK
TNLDEFAMGSSTENSAFFPTHNPWDLERVPGGSSGGSAAAVAAGFCAAALGSDTGGSIRQ
PASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPLTRSVKDAALILQVIAGKDEKDSTSV
PEEVPDYLKDLDMDISGATIGLPEEYFSEGLSEEVKTRIEEAVKIFEEMGLKVKKIRLPH
TPYAVAAYYIIAPAEASSNLARYDGVKYGLRVEGKDLIDMYKKTRSQGFGPEVKRRIMIG
TYALSAGYYDAYYKKASQVRTLIARDFAEAFKEVDFIIGPASPTPAFKIGERVSDPLAMY
LSDIYTISVNLAGIVGLTIPCGFTDKGLPVGLQIMGPHFSESKVLALGHKFEEKTGFTEK
YPES
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggaatggcataaactttctcttaatgagcagctagagaatttgcgccagggcaaggtc
tcaagtgtagagttaaccaaggccttgcttgattatattgaaaagaaggacccgcaggtt
aaggcctttttaaaaatcacccgggaagaagcgctttctcaggcccaagaggcggacaag
ctccgccaaaagggagaggataaacctcttttaggcgtgcctatcgccattaaagacaac
atttgtacccgcggtattactaccacctgtgcctcaaagatgcttgaaaattttgtgcca
ccctttgacgctacggtaataaccaagcttaaggaagccggggcggtaatcctgggaaag
actaaccttgatgaatttgctatgggttcttctacggaaaactcggcctttttccccacc
cacaacccgtgggatcttgagcgggtgccaggcggttcttcgggaggctcggcggccgca
gtggcagctggtttttgcgcggcggcccttggctcagataccggcggctctattaggcag
ccagcttctttttgcggggtagtagggctaaaacccacttatggtcgcgtttcccgttac
gggttggtagcttttgcctcttcgcttgaccagatcggcccgcttactcgttcggtaaaa
gacgctgcccttattttgcaggtaatagccggaaaagacgaaaaagactcaacttcagtc
cccgaagaggtgcctgactacttaaaagacctggatatggatatttcaggggctactatc
ggccttcctgaagaatattttagcgaaggtctatcagaagaagtgaaaaccagaatagaa
gaagcggtaaaaatatttgaagaaatgggcctaaaggtgaaaaaaataagacttccgcat
acgccttacgcggtggcggcttattacataattgctcccgcggaagctagttcaaacttg
gcccgttatgacggtgttaaatacggcctgcgtgtagaagggaaggacctgatagacatg
tacaaaaagacacgctctcagggctttggcccagaagtaaaaaggcgtatcatgattggc
acctatgccctttcagccggttactatgatgcatactacaaaaaggcctctcaggtgcgt
actctgattgccagagattttgccgaggcctttaaagaagttgattttattataggcccg
gccagtcctacccctgcttttaagattggagaaagagttagtgacccgctggccatgtat
ctttctgatatttataccatttctgttaatctggccggtatcgtaggtcttactatccct
tgtggttttaccgataaagggctacctgtagggctccagataatggggccacattttagt
gaaagtaaagtgctggctcttggccacaaatttgaggaaaagacaggatttaccgaaaag
tatcctgagtcatga

DBGET integrated database retrieval system