KEGG   Thermodesulfatator indicus: Thein_0727Help
Entry
Thein_0727        CDS       T01546                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00521  Streptomycin biosynthesis
tid00523  Polyketide sugar unit biosynthesis
tid01130  Biosynthesis of antibiotics
Module
tid_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Thein_0727
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Thein_0727
Enzymes [BR:tid01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Thein_0727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEH44607
UniProt: F8AC52
Position
complement(766358..766909)
Genome map
AA seq 183 aa AA seqDB search
MPFEFIKTEIPEVIIVKPKVFGDERGFFMETYKKSDFERAGIDTDFVQDNHSKSIKNVLR
GLHFQIEPKAQGKLVRCIRGKIFDVAVDIRKGSPSFGKWVGVELSEENKLMLWIPKGFAH
GFLTISEEAEIIYKVSGSEYSPEHDRSIRWNDPDIGINWPLKEEPILSEKDRKASFLVEW
LGG
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcccttcgaattcataaaaacggaaatcccagaggtgatcatcgtaaaaccgaaagtg
ttcggtgacgaaagaggttttttcatggaaacctataaaaagtctgattttgaaagggcc
ggaattgatacggattttgtccaagataatcattcaaaatctataaagaatgtgctacga
ggactacactttcagatcgagcctaaagctcaaggaaagcttgtaagatgcataagggga
aaaatttttgacgtggctgttgatataagaaaaggaagtccaagttttggaaagtgggta
ggagtagaactttccgaagaaaacaaactaatgctttggatacctaagggatttgctcat
ggttttctgaccatttctgaggaagcagagattatttataaggtttcaggtagtgaatat
tcgccggaacatgacagaagtatcaggtggaatgaccctgatataggtataaactggcct
ttgaaggaagaacctattctttcggaaaaggatagaaaggcgtcgtttttggttgagtgg
ttgggtggttga

DBGET integrated database retrieval system