KEGG   Thermodesulfatator indicus: Thein_0745Help
Entry
Thein_0745        CDS       T01546                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tid  Thermodesulfatator indicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tid00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Thein_0745
Enzymes [BR:tid01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Thein_0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
781610..782176
Genome map
AA seq 188 aa AA seqDB search
MLAQVKGKIVKKIPGKVFMATGPVVLEVTVPLNLSQNLPQEGEDYTLYTTLRLRGEVLEL
YGFNSWDNKIFFEKLISISSLGPRLALNILSVFEPEEFIEAVAKNDVKKLSEVPGIGPRR
AEKLCVELRARLELSPQTQSPLWNEALSALLNLGFAEKEARKALKNVFKEGEDLTVLIKE
ALKRLSNG
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcaagttaaaggtaaaatcgtaaaaaaaatcccaggtaaagtctttatggcc
acggggccggtggtgcttgaagttaccgtgcccttaaatttgagccaaaatcttcctcaa
gaaggcgaagactacactctttacaccaccttgcgcttacgaggagaagtccttgagctc
tatggctttaacagctgggacaacaagattttcttcgaaaaacttatttctatttcttcg
ttagggccaaggcttgccttgaatatcctttcagtttttgaacctgaagaattcatagaa
gcagtggccaaaaacgatgtcaaaaagctatctgaggtcccgggcattggccccagacgg
gcagaaaaactttgcgtagaattgcgtgcgcgccttgagctttcgcctcaaacacaaagt
cctttatggaatgaagcgctctcagccctgttgaacctcggctttgccgaaaaagaagcc
cgcaaggccttaaaaaatgtttttaaagagggagaagatcttacagtcttgattaaagag
gcccttaagagactttcaaatggctaa

DBGET integrated database retrieval system