KEGG   Thermodesulfatator indicus: Thein_0756Help
Entry
Thein_0756        CDS       T01546                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tid  Thermodesulfatator indicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thein_0756
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Thein_0756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
794715..795206
Genome map
AA seq 163 aa AA seqDB search
MGIGSNLGDRKFFCQRALWALKKLPGVYLIKWSSLYLTPPVGFSSDRYFYNLVAEIKTSL
SPWALLFSLWQIELANGRKRTGKVTDRSLDLDILLYEGATFDSKLLSLPHQKLHERSFVL
IPLVELLPHEKHPILNKTYEELLAKRPPSEKRAIKILGPLCLE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
attggtataggttcaaatttaggcgatcgtaaatttttttgtcagagggccctatgggcc
cttaaaaaattacccggtgtttatcttataaaatggtctagtctttatctcacgcctcca
gtaggattttcttctgataggtatttttataatctggtagcagagataaaaacttctctt
tcaccctgggcattactcttcagtttatggcagatagagttagccaatgggcgtaaaaga
acaggaaaagtaacagatcgttctcttgacctggatattttgctttacgaaggggcaact
tttgattctaaattgctttccttgcctcaccaaaaactccatgagcgctcttttgtttta
atcccacttgttgaattgcttcctcacgaaaaacatcctattcttaataagacatatgaa
gaacttttagctaagcggccaccttctgagaagagggccataaaaattttggggccgtta
tgtttagaataa

DBGET integrated database retrieval system