KEGG   Thermodesulfatator indicus: Thein_0818Help
Entry
Thein_0818        CDS       T01546                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thein_0818
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thein_0818
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thein_0818
Enzymes [BR:tid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thein_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
850296..851495
Genome map
AA seq 399 aa AA seqDB search
MPLPDKQGHFGPFGGRYVPETLMPALFELEEAYRHYKRDKSFKKELDFYFKTYVGRPTPL
YPASQLAKKLGGHLKIYLKREDLTHTGAHKINNTIGQVLLAKKMGKKRIIAETGAGQHGV
ATATAAALLGLECIVYMGAKDTVRQEMNVFRMELLGAKVIPVYSGTQTLKDAINEAIRDW
VTNVETTHYVIGSVMGPHPYPMIVRDFQSIIGKETRKQILAAEGRLPDVLIACVGGGSNA
MGLFYPFVEDQMVKMIGVEAAGTGLDTDKHSATLTVGEPGILHGMMTYLLQDKVGQVKGA
HSIAPGLDYPGVGPEHSFLKETGRAEYVTVDDQEALSGFRLLSETEGIIPALESAHAVAY
LAKIAKKLPQGTIVVVNLSGRGDKDVAAVREYLRRKSDD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgccacttccagacaagcaaggacattttggaccctttggcggacgatatgttccagaa
accttaatgccagctctttttgagctggaagaagcctatcgccattacaagcgagataag
tcctttaaaaaagaacttgatttttacttcaaaacttatgtaggaaggccaacccctctt
tatcccgcaagccagctagctaaaaaattaggcgggcacttaaaaatctacctcaaacgc
gaagacttaactcatactggtgcgcacaaaataaataacaccattggtcaggtacttctg
gccaaaaaaatgggaaaaaagcgcattattgccgaaacaggagctggccagcatggcgtc
gctacagctacggctgccgccctcctcggccttgaatgtattgtctatatgggtgccaaa
gacactgtgcgccaggaaatgaatgtcttccgtatggaacttctaggagccaaagttatc
cctgtctattctggcacccaaactttaaaagacgctataaatgaagccataagagactgg
gttaccaatgtggaaaccactcattacgtaatcggctcggtaatgggccctcacccctat
cccatgatagtgcgtgattttcaaagcataattggcaaagaaaccagaaaacaaatactt
gcggctgaaggacgtttgccagatgttctcatcgcctgtgtaggcggaggctcaaacgcc
atgggtttattttatccctttgtggaagatcagatggtcaaaatgataggtgttgaagcg
gcaggtacaggtcttgataccgacaaacattccgccactcttaccgtaggtgaaccagga
atactccacggcatgatgacctatctcctccaggacaaagtaggccaagtaaaaggggct
cattctatagccccggggctcgattatccaggtgtcgggccagaacattcctttttaaaa
gaaactggccgagctgaatacgtaaccgttgatgaccaagaagccctctctggttttaga
ctactttctgaaactgaaggcattatccctgcccttgaaagcgctcacgccgtggcttat
ctggctaaaatagctaaaaaactccctcaggggaccattgtagtggttaatctctctggc
cggggagataaagacgtagcggcagtgcgtgaatacctgcggaggaaaagtgatgactag

DBGET integrated database retrieval system