KEGG   Thermodesulfatator indicus: Thein_0819Help
Entry
Thein_0819        CDS       T01546                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thein_0819
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thein_0819
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thein_0819
Enzymes [BR:tid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thein_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
851488..852303
Genome map
AA seq 271 aa AA seqDB search
MTRGARAVEDAIRKANERGEAALIPFIEGGDPDLSATEDLLWALAEAGADVIELGFPFSD
PLADGPVIQEAAQRALRHNPTIDQFLDLVAKLRQKGFKVPLVIMGYLNPFFRYGLENFAR
RSRDVGLDGAIIPDLPLEEAKPWLKIARKHKLASILLAAPTTPPERLEKIAKASSGFLYY
VSITGITGTKKAIPEELALKLDLAKELSPVPVAVGFGISNPEQVKALSLHADAIIVGSAI
VKLIARHAEERKKLPELVGRFVKELKEATKR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactagaggcgcacgagcggtagaagatgctatccgtaaggctaacgagcgtggtgaa
gcggctcttatcccttttatagaaggaggcgaccctgacctttctgctaccgaggaccta
ctgtgggctctggccgaagctggggcagatgtcatagaactgggttttcctttttcagac
cctttagctgatggtcccgttattcaggaggccgctcaaagagccctgcgccacaacccg
actatcgatcaattccttgatctagtcgccaaactacgccaaaaaggctttaaagtgccg
ctagtgatcatgggttatttgaatccattttttcggtatgggctggaaaactttgctaga
agaagccgagatgtcggccttgacggcgctattattccggaccttcctctagaagaagct
aaaccctggttaaaaatcgcccgcaaacataaactggctagcattcttttggctgctcct
accacgccccctgaaaggcttgaaaaaattgccaaggcttcaagtggttttctctattat
gtttctataaccggtatcacggggacgaaaaaggctattcctgaagagcttgctttaaaa
cttgatctagctaaagagctaagcccagtgcctgtagctgtaggctttggcatatcaaat
cctgaacaggtaaaggccctttcacttcatgcagacgccatcatagtgggaagtgccatt
gttaagctcatagcccgacacgctgaagaaagaaaaaaacttccagagcttgttggccgc
tttgtaaaagaacttaaagaggctaccaaacgttaa

DBGET integrated database retrieval system