KEGG   Thermodesulfatator indicus: Thein_0819Help
Entry
Thein_0819        CDS       T01546                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00260  Glycine, serine and threonine metabolism
tid00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01130  Biosynthesis of antibiotics
tid01230  Biosynthesis of amino acids
Module
tid_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thein_0819
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thein_0819
Enzymes [BR:tid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thein_0819
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Radical_SAM PcrB His_biosynth BtpA ALF
Motif
Other DBs
NCBI-ProteinID: AEH44697
UniProt: F8ACJ3
Position
851488..852303
Genome map
AA seq 271 aa AA seqDB search
MTRGARAVEDAIRKANERGEAALIPFIEGGDPDLSATEDLLWALAEAGADVIELGFPFSD
PLADGPVIQEAAQRALRHNPTIDQFLDLVAKLRQKGFKVPLVIMGYLNPFFRYGLENFAR
RSRDVGLDGAIIPDLPLEEAKPWLKIARKHKLASILLAAPTTPPERLEKIAKASSGFLYY
VSITGITGTKKAIPEELALKLDLAKELSPVPVAVGFGISNPEQVKALSLHADAIIVGSAI
VKLIARHAEERKKLPELVGRFVKELKEATKR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgactagaggcgcacgagcggtagaagatgctatccgtaaggctaacgagcgtggtgaa
gcggctcttatcccttttatagaaggaggcgaccctgacctttctgctaccgaggaccta
ctgtgggctctggccgaagctggggcagatgtcatagaactgggttttcctttttcagac
cctttagctgatggtcccgttattcaggaggccgctcaaagagccctgcgccacaacccg
actatcgatcaattccttgatctagtcgccaaactacgccaaaaaggctttaaagtgccg
ctagtgatcatgggttatttgaatccattttttcggtatgggctggaaaactttgctaga
agaagccgagatgtcggccttgacggcgctattattccggaccttcctctagaagaagct
aaaccctggttaaaaatcgcccgcaaacataaactggctagcattcttttggctgctcct
accacgccccctgaaaggcttgaaaaaattgccaaggcttcaagtggttttctctattat
gtttctataaccggtatcacggggacgaaaaaggctattcctgaagagcttgctttaaaa
cttgatctagctaaagagctaagcccagtgcctgtagctgtaggctttggcatatcaaat
cctgaacaggtaaaggccctttcacttcatgcagacgccatcatagtgggaagtgccatt
gttaagctcatagcccgacacgctgaagaaagaaaaaaacttccagagcttgttggccgc
tttgtaaaagaacttaaagaggctaccaaacgttaa

DBGET integrated database retrieval system