KEGG   Thermodesulfatator indicus: Thein_0853Help
Entry
Thein_0853        CDS       T01546                                 

Definition
disulfide bond isomerase, DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tid  Thermodesulfatator indicus
Brite
Enzymes [BR:tid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Thein_0853
Secretion system [BR:tid02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Thein_0853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(890694..891422)
Genome map
AA seq 242 aa AA seqDB search
MKKFFLVVLFFVVWIGFGTSWAACPKRERAAQMLAPLFGGEKPKVISVKSTPIKGLCEVV
VEANGRKTPVYLDESGRYLVLGRIIDILARKDLTQERLTELNRLSPEKLKELKKLVAFSV
GKGPEVFFITDPDCPHCKRAEKIIFPLAEQGKIKVNVIFMPLEALHPHAKEKAVAIICDK
KGPKELMKGYQGTQCKEGEEKVKEALKILPRLGIRGTPTYIFPNGKIHAGVLEEKQIIEM
VK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattttttttagtggttttgttttttgttgtctggattggatttggtactagc
tgggcggcctgtcctaaaagagaaagagcagctcagatgcttgctcctctttttggtggt
gagaagcccaaagttattagtgtaaaatcgacgccaataaaaggcctttgcgaagtagta
gtagaggccaatggccggaaaactcctgtttatcttgatgagagtggccgttatctggtt
ttaggacgtattatagatattcttgctcgcaaagacttaactcaggaaagattgacagaa
cttaatcgtctttcgcctgaaaaactgaaagaattaaaaaaactagtggctttttctgta
ggtaaaggaccagaagtgtttttcataactgatcctgactgccctcactgtaaaagagct
gagaagataatttttccattagcggagcaaggaaagataaaagtaaatgtaatatttatg
cctttagaagccttgcaccctcatgccaaggaaaaagctgttgctattatttgtgataaa
aaggggcccaaagaattaatgaagggctaccagggaactcaatgtaaagagggagaggaa
aaagtaaaagaggccttaaaaattttaccaagactaggcatcagaggaactccgacttat
atttttcctaacggaaagatacacgcaggggttttggaagaaaaacaaattatagaaatg
gtgaaatag

DBGET integrated database retrieval system