KEGG   Thermodesulfatator indicus: Thein_0873Help
Entry
Thein_0873        CDS       T01546                                 

Definition
uroporphyrin-III C-methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tid  Thermodesulfatator indicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tid00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
911490..912998
Genome map
AA seq 502 aa AA seqDB search
MPGKVYLIGAGPGDPGLITEKGRRVIAKADVIVYDYLANPRFLALTREDAEKIYVGKKGG
DHTLSQEGINQLLVEKAKEGKTVARLKGGDPFLFGRGGEEAEVLVEHGIPFEIVPGVTSA
IAAPAYAGIPVTHREHTSTFTMVTGHEDPTKEDSAIDWEALARIGTIAFLMGMKNLPRIC
ENLLRHGKPEDTPVAVVRWGTTPRQKVVVGNLGNIVAKVEEAKLGPPSIILVGEVVKLRE
KLNWFETKPLFGKRIVVTRTRAQASQLVESLEECGAECLEIPTIKIVPPDSFEPLEQAIE
QIETYDWLIFTSVNGVQVFFERLFARGKDARALANTKVAAIGVATAELIKKYGLLVDLLP
QEFRAEGLLEALLKEELAGKKVLIPRALEAREILPEKLREAGAEVEVVPAYQTILPEEEA
TRLKKELEQGVDVITFTSSSTAKNLLKMLGDEARSLLSEVVLASIGPITTETLKKAGFTP
QVEAKEYTIPGLVKAILEYFRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccagggaaggtttatctcataggtgcaggtccaggagacccagggcttattacagag
aaaggaaggcgggtcatcgccaaggctgatgtcattgtttacgactacctagctaatccc
aggtttttggctctaaccagagaggacgccgaaaaaatctacgttggtaaaaaaggcggt
gatcataccctttcgcaagaaggtataaaccagttgctagtagaaaaggccaaagaaggg
aagaccgtagctcgccttaaagggggagacccttttctctttggccgtggtggcgaagaa
gctgaagttttggtggaacacggcatcccctttgaaatagtgccaggggttacttccgcc
attgccgctccggcttacgccggtatcccggtaactcaccgggagcatacttctactttt
accatggtcaccggccacgaagacccaactaaagaagactcagctattgactgggaggcc
ctggcccgcattggcactatagcctttcttatgggcatgaaaaacctgcctcgtatttgt
gaaaacttgcttcgccacggcaaacccgaagacacgccggtggcggtggtgcgctggggt
actaccccacggcaaaaggtggttgttggaaacctcggaaacattgtggctaaagtggag
gaggcaaagcttggcccaccgtccataatcctggtaggcgaagtggtaaagcttcgcgaa
aaacttaactggtttgaaactaagcccctttttggcaagcgcatagtggttacccgcaca
agggcccaggccagccagctcgtggagagccttgaagaatgcggggccgagtgtctagaa
attcctactataaaaattgtcccgccagactcttttgaaccgcttgagcaggctattgaa
caaatagaaacttacgactggttgatttttacttctgttaacggcgtgcaggtctttttt
gaaaggctctttgccagagggaaagacgcccgtgccctagccaacaccaaagtggcggct
attggcgtggctacagccgagcttatcaaaaaatacggcctgctggtggatctcctgccc
caagaatttcgggctgaagggcttttagaggccctcttaaaagaagagcttgccgggaaa
aaagtcttgatcccaagggcccttgaggcaagagagatactacctgaaaaattacgcgag
gcaggcgctgaggttgaagtagtccctgcttatcagacgattcttcctgaagaagaagcc
acccgattgaagaaagagcttgagcagggggtggatgttataacttttaccagttcttcc
acggctaaaaacttgctaaaaatgctgggagacgaagccagaagtttgctttcagaggta
gtgctagcctcaatcgggcctattaccaccgaaaccctaaagaaggccggttttactccc
caggtggaggccaaagaatacactattcccggactggttaaggcaattctagaatatttc
agagcctga

DBGET integrated database retrieval system