KEGG   Thermodesulfatator indicus: Thein_0888Help
Entry
Thein_0888        CDS       T01546                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_0888
   01230 Biosynthesis of amino acids
    Thein_0888
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_0888
   00030 Pentose phosphate pathway
    Thein_0888
   00051 Fructose and mannose metabolism
    Thein_0888
   00052 Galactose metabolism
    Thein_0888
  Energy metabolism
   00680 Methane metabolism
    Thein_0888
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Thein_0888
Protein phosphatases and associated proteins [BR:tid01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Thein_0888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(931646..932989)
Genome map
AA seq 447 aa AA seqDB search
MECQFEVLEEIIDENLDFRIESLGPNKITNPLKKEPISYISDDMKVALKISEAYLKQCLK
EKKLPPTVELAGPRPRIYFDPSKTRAAIVTCGGLCPGINDVIRSIVLTLYFSYGVKHIFG
IRYGLQGFIPKYGHDVVELTPDVVSNIHELGGTILGTSRGHQPIDEIVDALERLNVQILF
MIGGDGTFRAATLIKEEISRRHLKIVVVAVPKTIDNDIFLTSKTFGFDTAVEMACQAIRC
AHTEAIAVPNGIGLVKVMGRYSGFIAAAATLARKEVNFCLIPEADFDIEPPNGLLPVLEQ
RLEARKHAVIVVAEGAGQKYVRPDPPEYDASGNLKLGDIGKFLRDKIKEYFKQKGTEIYI
RYIDPSYIIRSVPAIVDDRIYCGFLGQYAVHAAMAGKTGLMVSYLNDRYIHIPLKTAIQK
RKQVDLKSRFWQSVLESTGQPSLKNTT
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggaatgccaatttgaagtccttgaagaaattattgatgagaatcttgacttcaggatt
gaatctttagggcccaacaaaataacaaatcctctaaaaaaagagcctatcagctatatc
tccgatgacatgaaagtggccttaaagatctcagaggcttatctaaaacaatgtttaaaa
gaaaaaaaacttcctcccactgttgaacttgctggcccaaggcctcgtatatattttgat
ccatctaaaactagagcggctattgttacctgtggaggattatgtccggggatcaatgac
gtcatacgttctattgtgcttacgctctatttttcctatggcgtgaaacatatctttggt
attagatacggccttcaaggttttatccctaaatatggccatgatgtagtagagctcaca
ccagatgttgtttctaacattcacgaactgggtggtactattttaggtacttctcgtggc
catcagcccattgatgaaatagttgatgctttggaacgtttgaatgttcagatacttttt
atgattggaggtgacggtactttccgtgccgccactcttattaaagaagagataagccga
cgccacttaaaaatagtagtggtagccgtccctaaaaccattgataacgatatttttctt
acttctaagacttttggttttgacacggcggtagaaatggcgtgtcaagctattcgctgc
gcgcacactgaagctatagctgtgccaaatggcataggattagtaaaagttatgggacgt
tattcaggctttatcgcagcggcggctaccttagcgcggaaagaagtaaatttttgttta
atacctgaggcagatttcgatatcgagcccccaaacggccttttgccagtgttagagcag
cgtcttgaagctcgtaagcacgcggtaatagtagtggctgaaggagctgggcaaaaatac
gttcgtcctgatccgcctgaatacgatgcttcagggaatctaaaactgggtgacattggc
aaatttttacgggacaaaattaaagagtatttcaaacaaaaaggtacagagatttacatt
cgttacatagaccccagttacatcataagaagtgtcccggctattgttgatgaccgaatc
tattgtgggttcttggggcaatatgctgtgcatgcggccatggccgggaaaaccgggtta
atggtaagttatttgaatgatcgctacatccatattcctcttaagacagcgattcagaaa
agaaaacaggttgacttaaaaagccgtttctggcagtcagtgcttgagtcaaccggccaa
ccgtccttaaaaaatacaacttag

DBGET integrated database retrieval system