KEGG   Thermodesulfatator indicus: Thein_1036Help
Entry
Thein_1036        CDS       T01546                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tid  Thermodesulfatator indicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Thein_1036
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Thein_1036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088744..1089697
Genome map
AA seq 317 aa AA seqDB search
MRVVGSGALNLDFFYEIEDLRLLKSSKGLVPGGEVWGSRKEFEVLREELEQKGRFIAQSG
GGSAANTIFALKTWGFETGFIGIVGADEEGEAILAELEGVDLSRVIRRGYSACCLIIIDA
QKDRAILVSPHSEEPSLTHFSCQTNSDEWLHLSSLITDEGFSFHCQLKKNHPGPFSIDPG
EIYARRGFEALKNFFQKAKLVFITSQELEILKITPEEITAFGPKLFLKQGGKGATIYDGK
PKNIPPATPPEIVDNTGAGDVFDAGVIAGILSGLSLEKAGKLGAAMAAISLRDYARKGYP
LPEEFSAKLKEIKNATG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtcgtcggctcaggtgcgcttaaccttgattttttctacgaaatagaagactta
cgcttgctcaaatcttccaaaggccttgtgcccgggggagaggtgtggggaagtcgtaaa
gaatttgaggtcctgcgggaagagcttgagcaaaagggccgttttatcgctcaaagcgga
ggtggctcggcggccaataccatttttgccctaaaaacctggggctttgaaacaggcttt
attggtatcgttggggccgacgaagaaggtgaggccattttagctgagcttgaaggggtt
gatttaagtcgagttataagacgaggttattcggcctgttgcctcattattattgacgcc
caaaaagatcgggctatcttggtctctccccattctgaagaaccatcccttacccatttt
tcttgccaaaccaactcagatgaatggctgcatctgagttctctcattacagacgaaggt
ttttctttccattgccagcttaaaaagaatcaccctggcccttttagcattgatcctggc
gagatctacgcccgaagaggttttgaggccttaaaaaactttttccaaaaagccaaactc
gtttttataaccagtcaggaactagaaatacttaaaattactcccgaagaaattaccgct
tttggccctaaactttttctaaaacaggggggaaagggagccaccatttatgacggcaag
cctaaaaacataccaccagctacaccacctgaaattgttgacaataccggtgcaggtgac
gtgtttgatgccggggtaatagccggtatcctctccggactatctttggaaaaagcagga
aaattaggagccgctatggccgctatttctttaagagattatgctagaaagggctatcct
ttgcctgaagaattttcggcgaaactaaaggagattaaaaatgcaaccggataa

DBGET integrated database retrieval system