KEGG   Thermodesulfatator indicus: Thein_1059Help
Entry
Thein_1059        CDS       T01546                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tid  Thermodesulfatator indicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Thein_1059
Enzymes [BR:tid01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Thein_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117521..1118552
Genome map
AA seq 343 aa AA seqDB search
MRYELLRKLCEAPGVPGAETPVKEIFLEAVKPLIDEIEEDPLGNVLLRKKGKGPRVLIDA
HLDEVAFMVAGIEDSFIRVVPLGGVDPKIFYGQRLEVWGRKRLPAVVTSYPPHLGQSKKD
FTIEELYLDVGLSTEKVAELVKIGDLVTFPAYFEETEEAIMAKALDDRVGLFVIFQALAQ
AKSKVDLFISATVQEEVGLRGAQGLKIKEALDAVLAIEGTFAADIPGVPGHLQATKIAKG
PEIRLCDARFVADRNLALGLAELATQKNIPHQLVVKNKGSTNATAFQVVRGAIRSTAISV
PVRYLHTPVNLAFKKDIEATIELLKAFLENPYHALNYRWSYSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgaacttttgcgtaagctttgtgaagcccccggtgtacctggagcggaaact
ccggtaaaagaaatttttctggaggcagttaaacccctgattgacgaaatagaggaagac
cctttgggcaatgttttgctccgcaaaaaaggcaaaggtccgcgggttttaattgatgct
catcttgatgaagtagcctttatggttgccggtatagaggactcttttataagggttgtt
cctctaggaggggtggatcctaaaattttttacgggcaaagacttgaagtatggggcagg
aaaaggcttcctgcagtagtaacttcttacccaccacatttaggtcaatctaaaaaagac
tttaccattgaagagttatatcttgacgtggggcttagtacagaaaaagttgctgaattg
gtaaaaattggagatttagtaacttttcctgcttatttcgaagaaaccgaagaggccatt
atggccaaggcccttgatgatagggtaggactctttgtaatctttcaagccttggctcaa
gcaaaatccaaagtggatctttttatttctgccactgtccaggaagaggtaggtctaaga
ggtgctcagggtttaaagataaaagaagctcttgacgctgtgctagctatagaaggcacc
tttgccgcagatatacctggagttcccggacatttacaggccactaaaatagctaaggga
ccagagattcgtctttgtgatgcccgttttgtggctgatcgcaatttggccctggggctc
gctgaattggctacccaaaaaaatattccccaccagttggtggtaaaaaacaaaggaagt
actaacgccacagcctttcaagtggttagaggcgctatccgttcaactgctatttctgtt
ccagtaagatatctacatacccctgttaatcttgcttttaaaaaagatatagaggccact
attgaactattaaaagcttttttggaaaatccttaccatgcgcttaattaccgttggtct
tactcctcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system