KEGG   Thermodesulfatator indicus: Thein_1059Help
Entry
Thein_1059        CDS       T01546                                 

Definition
(GenBank) peptidase M42 family protein
Organism
tid  Thermodesulfatator indicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1117521..1118552
Genome map
AA seq 343 aa AA seqDB search
MRYELLRKLCEAPGVPGAETPVKEIFLEAVKPLIDEIEEDPLGNVLLRKKGKGPRVLIDA
HLDEVAFMVAGIEDSFIRVVPLGGVDPKIFYGQRLEVWGRKRLPAVVTSYPPHLGQSKKD
FTIEELYLDVGLSTEKVAELVKIGDLVTFPAYFEETEEAIMAKALDDRVGLFVIFQALAQ
AKSKVDLFISATVQEEVGLRGAQGLKIKEALDAVLAIEGTFAADIPGVPGHLQATKIAKG
PEIRLCDARFVADRNLALGLAELATQKNIPHQLVVKNKGSTNATAFQVVRGAIRSTAISV
PVRYLHTPVNLAFKKDIEATIELLKAFLENPYHALNYRWSYSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgaacttttgcgtaagctttgtgaagcccccggtgtacctggagcggaaact
ccggtaaaagaaatttttctggaggcagttaaacccctgattgacgaaatagaggaagac
cctttgggcaatgttttgctccgcaaaaaaggcaaaggtccgcgggttttaattgatgct
catcttgatgaagtagcctttatggttgccggtatagaggactcttttataagggttgtt
cctctaggaggggtggatcctaaaattttttacgggcaaagacttgaagtatggggcagg
aaaaggcttcctgcagtagtaacttcttacccaccacatttaggtcaatctaaaaaagac
tttaccattgaagagttatatcttgacgtggggcttagtacagaaaaagttgctgaattg
gtaaaaattggagatttagtaacttttcctgcttatttcgaagaaaccgaagaggccatt
atggccaaggcccttgatgatagggtaggactctttgtaatctttcaagccttggctcaa
gcaaaatccaaagtggatctttttatttctgccactgtccaggaagaggtaggtctaaga
ggtgctcagggtttaaagataaaagaagctcttgacgctgtgctagctatagaaggcacc
tttgccgcagatatacctggagttcccggacatttacaggccactaaaatagctaaggga
ccagagattcgtctttgtgatgcccgttttgtggctgatcgcaatttggccctggggctc
gctgaattggctacccaaaaaaatattccccaccagttggtggtaaaaaacaaaggaagt
actaacgccacagcctttcaagtggttagaggcgctatccgttcaactgctatttctgtt
ccagtaagatatctacatacccctgttaatcttgcttttaaaaaagatatagaggccact
attgaactattaaaagcttttttggaaaatccttaccatgcgcttaattaccgttggtct
tactcctcatag

DBGET integrated database retrieval system