KEGG   Thermodesulfatator indicus: Thein_1059Help
Entry
Thein_1059        CDS       T01546                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tid  Thermodesulfatator indicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tid00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117521..1118552
Genome map
AA seq 343 aa AA seqDB search
MRYELLRKLCEAPGVPGAETPVKEIFLEAVKPLIDEIEEDPLGNVLLRKKGKGPRVLIDA
HLDEVAFMVAGIEDSFIRVVPLGGVDPKIFYGQRLEVWGRKRLPAVVTSYPPHLGQSKKD
FTIEELYLDVGLSTEKVAELVKIGDLVTFPAYFEETEEAIMAKALDDRVGLFVIFQALAQ
AKSKVDLFISATVQEEVGLRGAQGLKIKEALDAVLAIEGTFAADIPGVPGHLQATKIAKG
PEIRLCDARFVADRNLALGLAELATQKNIPHQLVVKNKGSTNATAFQVVRGAIRSTAISV
PVRYLHTPVNLAFKKDIEATIELLKAFLENPYHALNYRWSYSS
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagatacgaacttttgcgtaagctttgtgaagcccccggtgtacctggagcggaaact
ccggtaaaagaaatttttctggaggcagttaaacccctgattgacgaaatagaggaagac
cctttgggcaatgttttgctccgcaaaaaaggcaaaggtccgcgggttttaattgatgct
catcttgatgaagtagcctttatggttgccggtatagaggactcttttataagggttgtt
cctctaggaggggtggatcctaaaattttttacgggcaaagacttgaagtatggggcagg
aaaaggcttcctgcagtagtaacttcttacccaccacatttaggtcaatctaaaaaagac
tttaccattgaagagttatatcttgacgtggggcttagtacagaaaaagttgctgaattg
gtaaaaattggagatttagtaacttttcctgcttatttcgaagaaaccgaagaggccatt
atggccaaggcccttgatgatagggtaggactctttgtaatctttcaagccttggctcaa
gcaaaatccaaagtggatctttttatttctgccactgtccaggaagaggtaggtctaaga
ggtgctcagggtttaaagataaaagaagctcttgacgctgtgctagctatagaaggcacc
tttgccgcagatatacctggagttcccggacatttacaggccactaaaatagctaaggga
ccagagattcgtctttgtgatgcccgttttgtggctgatcgcaatttggccctggggctc
gctgaattggctacccaaaaaaatattccccaccagttggtggtaaaaaacaaaggaagt
actaacgccacagcctttcaagtggttagaggcgctatccgttcaactgctatttctgtt
ccagtaagatatctacatacccctgttaatcttgcttttaaaaaagatatagaggccact
attgaactattaaaagcttttttggaaaatccttaccatgcgcttaattaccgttggtct
tactcctcatag

DBGET integrated database retrieval system