KEGG   Thermodesulfatator indicus: Thein_1198Help
Entry
Thein_1198        CDS       T01546                                 

Definition
pseudouridine synthase
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
tid  Thermodesulfatator indicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1266838..1267536)
Genome map
AA seq 232 aa AA seqDB search
MKDLIIYEDNHLLVVEKPGGLLVQGDSTGDITLLSMAKEYLKEKYQKPGNVYLGVVHRLD
RVTSGVVIFARTSKAAQRLAKFFREKLVKKHYLAVVHGSPPPKGLLEDKIAWDENKRKAY
ISSKGKEASLVYLKLRTKNKKSLLLVQPITGRKHQIRVQLAKRKHPIVGDVKYGSKERIY
FGRAILLHAWRIVLPHPVKDEILRFEAGLPFYWPKEFYPPAKIPWLKTERKL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatttaattatctacgaagataatcatttactggtggtggaaaagcccggtggt
cttctcgttcagggggacagcaccggtgatattaccctcttatccatggccaaggaatat
ctaaaagaaaaataccagaaaccgggaaacgtttacctgggagtagtgcatcggcttgac
cgtgtaacttcaggagtggttatctttgcccgcacttccaaagccgcccagaggctcgcc
aagttttttcgagaaaagctggtaaaaaaacactacttggcggtggtgcacggttcccct
cctcctaaaggcctccttgaagacaagattgcctgggacgaaaacaaaagaaaagcctat
atttctagcaaaggcaaagaggcaagccttgtttaccttaaacttcgcaccaagaataaa
aaatcccttttactggtgcagcccataaccggacgtaagcatcaaattcgggtgcagtta
gccaaaagaaaacaccccattgtgggcgacgttaaatacggctccaaagaacgaatctat
ttcggtcgggccatactgcttcacgcctggcgcattgttcttcctcacccggttaaagac
gaaattttgcgctttgaggccggccttcctttctactggcccaaagaattttatccacca
gctaagatcccttggctaaaaaccgaaagaaagctttag

DBGET integrated database retrieval system