KEGG   Thermodesulfatator indicus: Thein_1209Help
Entry
Thein_1209        CDS       T01546                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tid  Thermodesulfatator indicus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Thein_1209
Enzymes [BR:tid01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Thein_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1275382..1275948
Genome map
AA seq 188 aa AA seqDB search
MKFPRTAMAEFARKAGDEGLMVGTEGNLSVRVKDKVYITPSGVFKKELSPQDIVVLDLEG
NVLEGRNPSSEYRMHLALYEAREDITAIIHAHPPYTLALDLTGEDFSRDYLAEMPIILGK
ISRVPYREPGTEELAQEVAKAAKETNVLVLERHGALTLGKSLSQALNLMLVLEKVCKVIL
LAKTCKAF
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttccgcgcactgccatggccgagtttgctcgtaaggccggagacgaaggctta
atggttggcaccgaaggtaatctttcggtaagagttaaagacaaagtttatataaccccc
tcgggtgtttttaaaaaagagcttagtcctcaagatatagttgttcttgaccttgaggga
aatgtgcttgaaggacgaaaccctagttctgaatatagaatgcatctagccctttatgag
gctcgtgaggatattaccgccatcatccatgctcatcctccttacactttggctttggat
ttaaccggtgaagactttagtcgcgattatttggccgagatgcctataattcttgggaaa
attagccgtgtgccatacagagaacctgggaccgaagaattagctcaggaggtagctaag
gccgccaaagaaacaaatgttttagtccttgagcggcacggagcgctaactctggggaaa
agcctgtctcaagccttaaatctcatgctagtgcttgaaaaagtatgtaaagtaattctt
ctggccaaaacctgtaaagccttttag

DBGET integrated database retrieval system