KEGG   Thermodesulfatator indicus: Thein_1244Help
Entry
Thein_1244        CDS       T01546                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00620  Pyruvate metabolism
tid00640  Propanoate metabolism
tid00680  Methane metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1244
   00620 Pyruvate metabolism
    Thein_1244
   00640 Propanoate metabolism
    Thein_1244
  Energy metabolism
   00680 Methane metabolism
    Thein_1244
Enzymes [BR:tid01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Thein_1244
Lipid biosynthesis proteins [BR:tid01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Thein_1244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEH45112
UniProt: F8A8M3
Position
complement(1307012..1309003)
Genome map
AA seq 663 aa AA seqDB search
MADPTKIESVLKEERIVYPPQEGRDEAYISSKFDYEEIYRYSLNDPDGFWSERAKELITW
FKLWDRTCYWDFHKPEIRWFEGGKLNACYNCVDRHLTDETRNKAAIIWQGEPDEEVKVYT
YEMLHREVCRFANVLKKLGIKKGDRVSIYLPMIPELPIVMLACARIGAIHSVVFGGFSAE
SLKTRIQDCEAKLLITADGYWRSGRKIQAKKNADEALKDCPTVEKCIVVKRLGLDINWVE
GRDIWYHEAINAEDISDWCECEEMDAEDVLFILYTSGSTGKPKGVFHTTGGYLVYVAHTL
QWVFDLKPEDIFWCTADIGWITGHSYIVYGPLSLAATQIMYEGVPTYPHPGRFWELCQKF
KVNLFYTAPTVIRALMRAGDEWPHKYDLSSLRVLGSVGEPINPEAWWWYYEHVGQRRCPI
VDTWWQTETGGFLISPLPYAIPQKPGSATLPLPGVEPVILKDDGTPADVNEGGHLCMKRA
WPGMLRGVWGDPQRFKDVYFSRFPGYYYTGDGARRDEDGYFWIMGRLDDVINVSGHRLGT
MELESALVAHPAVAEAAVIGYPHEIKGEAIYAFVILKEGYEPSEELRQELKQHMRKVIGP
IATPDYIQFVSGLPKTRSGKIMRRILRKIVAGQYEDLGDTSTLADPSVIDELIKGREELM
GKK
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcggatccgaccaagattgaaagcgttttaaaagaagaacgcattgtttatcctccg
caggaggggcgggatgaggcttacattagcagcaagtttgattatgaagaaatttatcgt
tactccttaaatgatcctgatggtttctggagtgagcgggccaaagaattaattacctgg
tttaagctctgggatcgcacctgttactgggattttcataagccagaaattcgctggttt
gagggcggaaaattaaatgcttgctacaattgtgttgaccgccacttaacagatgaaacc
cgcaacaaggccgctatcatctggcagggagaacctgacgaagaagtcaaagtttacacc
tacgagatgctccaccgtgaagtctgtcgttttgccaatgtccttaaaaagcttggtata
aaaaagggcgatcgtgtttctatttatcttcccatgatccctgaacttccgattgttatg
ctggcttgcgcccgcattggcgccattcactcggttgtctttggtggtttttcagccgag
agcttaaagacccgtattcaggattgtgaagccaaacttctcattacagccgacgggtac
tggcgttctggccgcaagattcaggccaaaaagaatgctgatgaggccttaaaagattgc
cccactgttgaaaaatgtattgtagtaaaaaggcttggccttgacattaactgggtagaa
ggccgcgatatctggtatcacgaagccatcaatgccgaagatatttctgactggtgtgaa
tgtgaagaaatggacgctgaagacgtactttttattctttacacttcaggctctaccggg
aagcccaagggcgtttttcatactacgggaggctatctggtctatgtggctcataccctt
cagtgggtatttgacttgaagcctgaagatatattctggtgcaccgctgacattggctgg
attaccggtcattcctatatcgtttacgggcctttgagtcttgcggccacccagattatg
tatgaaggtgtgcccacttatccgcacccggggcgtttctgggagctctgccaaaagttc
aaggtaaatcttttttacacggcgccaacagttattcgggctttgatgagggctggtgat
gaatggcctcataagtatgatctttccagcttgagggtcctcggttcggtgggtgagcct
attaacccggaggcctggtggtggtattacgagcacgtaggccagaggcgttgccccatt
gtagatacctggtggcaaacagagaccggcggtttccttatttctcccttgccctatgct
attccgcaaaaacccggctcagccactttacctttacccggagttgaacctgtaattctc
aaagacgacggtactccggctgatgtaaacgaaggtggccatctttgcatgaaaagagcc
tggccgggaatgctccgtggtgtgtggggtgacccgcagcgttttaaagacgtttatttc
agccgcttccctggctattattataccggtgacggtgctcgccgtgatgaagacggctat
ttctggattatggggcgccttgatgacgttatcaatgtctccggtcaccgtctaggtacc
atggaacttgagtctgctctcgtggcccatccggcagtggccgaagctgcggttatcggt
tatcctcacgaaattaaaggcgaagccatctacgctttcgtaatcctcaaggaaggctac
gagccctctgaagaactccgtcaggaactcaagcaacatatgcgtaaagttatcgggccg
attgctactcctgattacattcagttcgtctcaggtcttcccaagacccgcagtggaaag
attatgcgtcgtattttacgtaaaattgtggctggtcaatacgaagaccttggtgatact
tcaacgctggctgatccttcagtcattgatgaacttattaagggaagagaagaattaatg
ggcaaaaagtaa

DBGET integrated database retrieval system