KEGG   Thermodesulfatator indicus: Thein_1281Help
Entry
Thein_1281        CDS       T01546                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thein_1281
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Thein_1281
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Thein_1281
Enzymes [BR:tid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Thein_1281
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1341854..1343230
Genome map
AA seq 458 aa AA seqDB search
MDDTKILLSENELPEAWYNIIPRLPNPPAPPLNPQTKEPVKPEDLEPIFPKSLIEQEMSP
EPWVEIPGAVREIYKLWRPTPLQRARNLEKALGTPARIYFKNESVSPPGSHKPNTAVAQA
YYNKEAGIKRLATETGAGQWGSALSFACKLFGLECTVYMVKVSFEQKPFRKSLMHIWGAE
VFPSPTNRTQAGRKILEENPDSTGSLGIAISEAVEDAATHEDTNYALGSVLNHVLLHQTV
IGLETQKQLALAGEKPDILIGCVGGGSNFAGFTFPFIGDIIEGKLEAEVIAVEPTSCPTL
TKGIYTYDFGDTAGLTPLLLMHTLGHSFEPPAIHAGGLRYHGDAPLVCQLVKDGYIKPRA
YPQNPCFEAAVLFAQTEGIIPAPETSHAIKAAVDEALKCKETGEEKVIVFGFSGHGHFDL
AAYDAYLEGKLEDYEYPEEKIKEALEALAHFPKFPTGL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggacgatactaagattttactttcagagaatgaactcccagaggcctggtataatatt
attccgaggctacctaacccacccgctccaccacttaaccctcaaaccaaagagcccgta
aaaccagaagaccttgagccgattttccctaaatctcttattgagcaggagatgagccct
gagccgtgggtggaaattccaggcgccgtcagagaaatttataaactctggcggccaaca
ccccttcagcgggctcgcaacctggaaaaggccctggggactccggctcgcatttacttt
aaaaacgaaagcgtaagcccgcctggtagccataagcctaacaccgctgtggcccaggct
tactataataaagaagccggtataaaaaggctggccacagaaaccggggctggccagtgg
ggaagtgccctttcctttgcctgtaaactctttggccttgagtgcacggtttatatggta
aaagtctcttttgaacaaaagccttttcgtaaaagccttatgcacatttggggggcagag
gtcttcccttcgcccaccaatcgcacccaggctggccgtaaaattcttgaggaaaatcct
gactctaccggaagccttggtatagccatttccgaagccgtggaagacgccgccacccat
gaagacaccaactatgccctgggaagtgtcttaaaccatgtgttgcttcatcaaacggta
ataggccttgaaacccaaaagcagcttgctttagccggagaaaaaccagatatcttgatt
ggctgtgtaggtggtggtagtaactttgccggattcacttttccttttatcggtgacata
attgaaggcaaacttgaggcggaagtcatagccgttgagcccacgagctgccccaccttg
accaaaggtatctacacttatgatttcggcgacaccgccgggcttaccccgcttcttttg
atgcataccctggggcattcctttgaaccaccggctattcacgcgggagggttgcgctat
catggcgacgccccactggtttgccaactggtcaaagatggctatataaagccgcgggcc
tatccgcagaacccctgctttgaagcggcggtcctttttgcccaaacagagggcataatc
cctgctcctgaaaccagccacgctataaaggctgccgttgacgaggccttaaagtgcaaa
gaaacaggggaagaaaaagtaattgtgtttgggtttagcgggcacggccactttgacctg
gcggcttacgacgcctatcttgagggcaaattagaagactacgaataccctgaagaaaaa
attaaagaagccttagaagccctggcccatttccccaaatttccaacgggcctctag

DBGET integrated database retrieval system