KEGG   Thermodesulfatator indicus: Thein_1300Help
Entry
Thein_1300        CDS       T01546                                 

Definition
argininosuccinate lyase
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thein_1300
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thein_1300
   00330 Arginine and proline metabolism
    Thein_1300
Enzymes [BR:tid01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Thein_1300
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364280..1365659
Genome map
AA seq 459 aa AA seqDB search
MAQKPWGGRFSEETDKLVEEFTASVHYDKRLALYDIRGSIAHARMLGKTGIIPLEDAEKI
IAGLKEIEKDIKEGRFKWRKDLEDVHMNIEAALYEKIGPVAGKLHTARSRNDQVATDVRL
FLRDVIDETLSRLKDLRKALVEKAKENLEVILPGFTHLQHAQPVLLAHHLMAYYEMFTRD
AKRFAFVRQETNVCPLGSAALAGTPFPVDREMVAQELGFAGITRNSMDAVSDRDFIVSFL
AAASLAFVHLSRLSEELILWISQEFGFIDLPDKLCTGSSIMPQKKNPDVAELIRGKSGRV
FGNLFTLLTVLKGLPMTYNRDLQEDKEPLFDTVDTLLAVLALAKELIVGLKVNRERMRKA
CEEGHLTATDLADYLVTKGLPFREAHHVVGRLVAYCEEKGQKLWELPIEKLKEFSELIGE
DVYEWLTLEGSVSRRKVVGGTAPEQVEKAIYQAEKELEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaagccctggggaggacgtttttccgaagaaacagataaactggtagaggag
ttcaccgcctcggttcactacgataaaagacttgccctttacgacattcgcggaagcata
gctcacgcccgcatgctgggaaaaacgggcattattcccttagaagacgccgaaaaaata
atagctggtcttaaagaaattgaaaaagacataaaagaaggccgttttaagtggcgcaaa
gatttagaagacgtgcacatgaacatagaggccgccctttacgaaaagattggcccggtg
gcgggaaagcttcacaccgcccgcagccggaacgaccaggtggccacagacgtaaggctt
tttctgcgagacgttatagacgaaaccttaagccgcttaaaagacttgagaaaagccctg
gtagaaaaggccaaagagaacctggaagtaattcttcccggtttcacccatctccaacac
gcccagccggtacttctggcccaccaccttatggcttattacgagatgtttacccgtgat
gccaaacgttttgcctttgtccgccaggagacaaacgtttgtccgttgggaagtgccgcc
cttgcaggaacaccctttcctgtggatcgtgagatggtggcccaggaacttggctttgca
ggcattaccagaaacagtatggacgccgtttctgatagggactttatcgtctccttcctt
gcggccgcgtctctcgcttttgttcatctttcgcgcctttcagaagaactaattctctgg
ataagccaggagttcggttttatagacctgccggataaactttgcaccggtagctctatt
atgccccagaaaaaaaatcccgacgtggcggagctcatcagaggaaaaagcggccgcgtt
tttggaaatctcttcactcttttaacggtgttaaaaggccttccaatgacctataaccgt
gacctccaggaagacaaagagcctctttttgatacggtagatacccttttggcggtcctg
gctctggccaaagaattgatagtgggccttaaagtgaaccgggagcgcatgcgcaaggcc
tgcgaggaagggcatctcacggctacagatctggctgattacctggttactaaagggcta
ccctttcgcgaggcccaccacgtggtaggccgtctggtggcctattgtgaagaaaagggc
caaaagctctgggagttgccaattgaaaagctaaaagagttttccgagctaatcggagaa
gatgtttatgagtggcttacccttgaaggttcggtgtccaggcgtaaagtagtggggggc
acggccccagagcaagtggaaaaagccatttatcaggcggaaaaagaactggaggcttaa

DBGET integrated database retrieval system