KEGG   Thermodesulfatator indicus: Thein_1300Help
Entry
Thein_1300        CDS       T01546                                 

Definition
argininosuccinate lyase
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Thein_1300
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Thein_1300
   00330 Arginine and proline metabolism
    Thein_1300
Enzymes [BR:tid01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Thein_1300
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_1300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364280..1365659
Genome map
AA seq 459 aa AA seqDB search
MAQKPWGGRFSEETDKLVEEFTASVHYDKRLALYDIRGSIAHARMLGKTGIIPLEDAEKI
IAGLKEIEKDIKEGRFKWRKDLEDVHMNIEAALYEKIGPVAGKLHTARSRNDQVATDVRL
FLRDVIDETLSRLKDLRKALVEKAKENLEVILPGFTHLQHAQPVLLAHHLMAYYEMFTRD
AKRFAFVRQETNVCPLGSAALAGTPFPVDREMVAQELGFAGITRNSMDAVSDRDFIVSFL
AAASLAFVHLSRLSEELILWISQEFGFIDLPDKLCTGSSIMPQKKNPDVAELIRGKSGRV
FGNLFTLLTVLKGLPMTYNRDLQEDKEPLFDTVDTLLAVLALAKELIVGLKVNRERMRKA
CEEGHLTATDLADYLVTKGLPFREAHHVVGRLVAYCEEKGQKLWELPIEKLKEFSELIGE
DVYEWLTLEGSVSRRKVVGGTAPEQVEKAIYQAEKELEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaagccctggggaggacgtttttccgaagaaacagataaactggtagaggag
ttcaccgcctcggttcactacgataaaagacttgccctttacgacattcgcggaagcata
gctcacgcccgcatgctgggaaaaacgggcattattcccttagaagacgccgaaaaaata
atagctggtcttaaagaaattgaaaaagacataaaagaaggccgttttaagtggcgcaaa
gatttagaagacgtgcacatgaacatagaggccgccctttacgaaaagattggcccggtg
gcgggaaagcttcacaccgcccgcagccggaacgaccaggtggccacagacgtaaggctt
tttctgcgagacgttatagacgaaaccttaagccgcttaaaagacttgagaaaagccctg
gtagaaaaggccaaagagaacctggaagtaattcttcccggtttcacccatctccaacac
gcccagccggtacttctggcccaccaccttatggcttattacgagatgtttacccgtgat
gccaaacgttttgcctttgtccgccaggagacaaacgtttgtccgttgggaagtgccgcc
cttgcaggaacaccctttcctgtggatcgtgagatggtggcccaggaacttggctttgca
ggcattaccagaaacagtatggacgccgtttctgatagggactttatcgtctccttcctt
gcggccgcgtctctcgcttttgttcatctttcgcgcctttcagaagaactaattctctgg
ataagccaggagttcggttttatagacctgccggataaactttgcaccggtagctctatt
atgccccagaaaaaaaatcccgacgtggcggagctcatcagaggaaaaagcggccgcgtt
tttggaaatctcttcactcttttaacggtgttaaaaggccttccaatgacctataaccgt
gacctccaggaagacaaagagcctctttttgatacggtagatacccttttggcggtcctg
gctctggccaaagaattgatagtgggccttaaagtgaaccgggagcgcatgcgcaaggcc
tgcgaggaagggcatctcacggctacagatctggctgattacctggttactaaagggcta
ccctttcgcgaggcccaccacgtggtaggccgtctggtggcctattgtgaagaaaagggc
caaaagctctgggagttgccaattgaaaagctaaaagagttttccgagctaatcggagaa
gatgtttatgagtggcttacccttgaaggttcggtgtccaggcgtaaagtagtggggggc
acggccccagagcaagtggaaaaagccatttatcaggcggaaaaagaactggaggcttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system