KEGG   Thermodesulfatator indicus: Thein_1300Help
Entry
Thein_1300        CDS       T01546                                 

Definition
argininosuccinate lyase
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tid01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tid00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tid00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1364280..1365659
Genome map
AA seq 459 aa AA seqDB search
MAQKPWGGRFSEETDKLVEEFTASVHYDKRLALYDIRGSIAHARMLGKTGIIPLEDAEKI
IAGLKEIEKDIKEGRFKWRKDLEDVHMNIEAALYEKIGPVAGKLHTARSRNDQVATDVRL
FLRDVIDETLSRLKDLRKALVEKAKENLEVILPGFTHLQHAQPVLLAHHLMAYYEMFTRD
AKRFAFVRQETNVCPLGSAALAGTPFPVDREMVAQELGFAGITRNSMDAVSDRDFIVSFL
AAASLAFVHLSRLSEELILWISQEFGFIDLPDKLCTGSSIMPQKKNPDVAELIRGKSGRV
FGNLFTLLTVLKGLPMTYNRDLQEDKEPLFDTVDTLLAVLALAKELIVGLKVNRERMRKA
CEEGHLTATDLADYLVTKGLPFREAHHVVGRLVAYCEEKGQKLWELPIEKLKEFSELIGE
DVYEWLTLEGSVSRRKVVGGTAPEQVEKAIYQAEKELEA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaagccctggggaggacgtttttccgaagaaacagataaactggtagaggag
ttcaccgcctcggttcactacgataaaagacttgccctttacgacattcgcggaagcata
gctcacgcccgcatgctgggaaaaacgggcattattcccttagaagacgccgaaaaaata
atagctggtcttaaagaaattgaaaaagacataaaagaaggccgttttaagtggcgcaaa
gatttagaagacgtgcacatgaacatagaggccgccctttacgaaaagattggcccggtg
gcgggaaagcttcacaccgcccgcagccggaacgaccaggtggccacagacgtaaggctt
tttctgcgagacgttatagacgaaaccttaagccgcttaaaagacttgagaaaagccctg
gtagaaaaggccaaagagaacctggaagtaattcttcccggtttcacccatctccaacac
gcccagccggtacttctggcccaccaccttatggcttattacgagatgtttacccgtgat
gccaaacgttttgcctttgtccgccaggagacaaacgtttgtccgttgggaagtgccgcc
cttgcaggaacaccctttcctgtggatcgtgagatggtggcccaggaacttggctttgca
ggcattaccagaaacagtatggacgccgtttctgatagggactttatcgtctccttcctt
gcggccgcgtctctcgcttttgttcatctttcgcgcctttcagaagaactaattctctgg
ataagccaggagttcggttttatagacctgccggataaactttgcaccggtagctctatt
atgccccagaaaaaaaatcccgacgtggcggagctcatcagaggaaaaagcggccgcgtt
tttggaaatctcttcactcttttaacggtgttaaaaggccttccaatgacctataaccgt
gacctccaggaagacaaagagcctctttttgatacggtagatacccttttggcggtcctg
gctctggccaaagaattgatagtgggccttaaagtgaaccgggagcgcatgcgcaaggcc
tgcgaggaagggcatctcacggctacagatctggctgattacctggttactaaagggcta
ccctttcgcgaggcccaccacgtggtaggccgtctggtggcctattgtgaagaaaagggc
caaaagctctgggagttgccaattgaaaagctaaaagagttttccgagctaatcggagaa
gatgtttatgagtggcttacccttgaaggttcggtgtccaggcgtaaagtagtggggggc
acggccccagagcaagtggaaaaagccatttatcaggcggaaaaagaactggaggcttaa

DBGET integrated database retrieval system