KEGG   Thermodesulfatator indicus: Thein_1412Help
Entry
Thein_1412        CDS       T01546                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_1412
   01230 Biosynthesis of amino acids
    Thein_1412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1412
   00051 Fructose and mannose metabolism
    Thein_1412
   00562 Inositol phosphate metabolism
    Thein_1412
Enzymes [BR:tid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thein_1412
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thein_1412
  Exosomal proteins of bladder cancer cells
   Thein_1412
  Exosomal proteins of melanoma cells
   Thein_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484072..1484836
Genome map
AA seq 254 aa AA seqDB search
MKRRPLIAGNWKMHKTVPETLAYIEAFKSLVAGVEDRDIMLAPPFTSLDAAERALEGTNI
YLGAQNCHWADEGAFTGEISPKMLADIGVTYVIIGHSERRHIFGETDKVIRQKIEAVLKY
DLIPILCIGETLEEREAGKTLKVLETQLKEGLKGFSVADLKSLVVAYEPVWAIGTGKTAT
PEQAEEAHAFVRKILAEMFNQEFADNLRILYGGSVKPENVVGLMARPDIDGALVGGASLK
PDVFAKIVCFGRME
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagaccactcattgcgggaaactggaaaatgcataaaaccgtgccagagacg
ttggcttatattgaagcctttaaatctttggtggctggggtagaagatagagatataatg
cttgcgccacctttcacctctcttgatgcggctgaacgggccttagaaggtacaaatatt
tatcttggggcccaaaactgccactgggctgatgaaggggcgtttactggtgaaatctca
cctaaaatgcttgccgatataggcgtaacatatgtgattataggtcattctgaacgccgt
catatttttggcgaaaccgataaagttattcgtcaaaagatagaagcggtattgaaatat
gaccttattccgattttgtgtatcggagagactttagaagaaagggaagcgggaaaaacc
ctaaaagtccttgaaacccagctcaaagaagggcttaaaggcttttcagtggcggactta
aagtctttggtagtggcttacgagcctgtgtgggctatagggacaggcaaaaccgcaact
cctgaacaggccgaagaggcccatgcctttgtcagaaagattttggcagaaatgtttaat
caggaatttgctgataatttaagaattctttacgggggtagcgtaaagccagaaaatgtt
gtaggacttatggcacgtccggatatagatggggctttagttggaggggcctctcttaag
ccagacgtttttgctaagatagtttgtttcgggaggatggaataa

DBGET integrated database retrieval system