KEGG   Thermodesulfatator indicus: Thein_1412Help
Entry
Thein_1412        CDS       T01546                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_1412
   01230 Biosynthesis of amino acids
    Thein_1412
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1412
   00051 Fructose and mannose metabolism
    Thein_1412
   00562 Inositol phosphate metabolism
    Thein_1412
Enzymes [BR:tid01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Thein_1412
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Thein_1412
  Exosomal proteins of bladder cancer cells
   Thein_1412
  Exosomal proteins of melanoma cells
   Thein_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1484072..1484836
Genome map
AA seq 254 aa AA seqDB search
MKRRPLIAGNWKMHKTVPETLAYIEAFKSLVAGVEDRDIMLAPPFTSLDAAERALEGTNI
YLGAQNCHWADEGAFTGEISPKMLADIGVTYVIIGHSERRHIFGETDKVIRQKIEAVLKY
DLIPILCIGETLEEREAGKTLKVLETQLKEGLKGFSVADLKSLVVAYEPVWAIGTGKTAT
PEQAEEAHAFVRKILAEMFNQEFADNLRILYGGSVKPENVVGLMARPDIDGALVGGASLK
PDVFAKIVCFGRME
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcagaccactcattgcgggaaactggaaaatgcataaaaccgtgccagagacg
ttggcttatattgaagcctttaaatctttggtggctggggtagaagatagagatataatg
cttgcgccacctttcacctctcttgatgcggctgaacgggccttagaaggtacaaatatt
tatcttggggcccaaaactgccactgggctgatgaaggggcgtttactggtgaaatctca
cctaaaatgcttgccgatataggcgtaacatatgtgattataggtcattctgaacgccgt
catatttttggcgaaaccgataaagttattcgtcaaaagatagaagcggtattgaaatat
gaccttattccgattttgtgtatcggagagactttagaagaaagggaagcgggaaaaacc
ctaaaagtccttgaaacccagctcaaagaagggcttaaaggcttttcagtggcggactta
aagtctttggtagtggcttacgagcctgtgtgggctatagggacaggcaaaaccgcaact
cctgaacaggccgaagaggcccatgcctttgtcagaaagattttggcagaaatgtttaat
caggaatttgctgataatttaagaattctttacgggggtagcgtaaagccagaaaatgtt
gtaggacttatggcacgtccggatatagatggggctttagttggaggggcctctcttaag
ccagacgtttttgctaagatagtttgtttcgggaggatggaataa

DBGET integrated database retrieval system