KEGG   Thermodesulfatator indicus: Thein_1418Help
Entry
Thein_1418        CDS       T01546                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00020  Citrate cycle (TCA cycle)
tid00620  Pyruvate metabolism
tid00633  Nitrotoluene degradation
tid00640  Propanoate metabolism
tid00650  Butanoate metabolism
tid00680  Methane metabolism
tid01100  Metabolic pathways
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Module
tid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1418
   00020 Citrate cycle (TCA cycle)
    Thein_1418
   00620 Pyruvate metabolism
    Thein_1418
   00640 Propanoate metabolism
    Thein_1418
   00650 Butanoate metabolism
    Thein_1418
  Energy metabolism
   00680 Methane metabolism
    Thein_1418
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thein_1418
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thein_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR DUF5343 DUF3572
Motif
Other DBs
NCBI-ProteinID: AEH45284
UniProt: F8A9Z8
Position
1489708..1490259
Genome map
AA seq 183 aa AA seqDB search
MIEVRLHGRGGQGAVTSAELIAISAINQGNYAQAFPSFGPERRGAPVMAFVRISDQRIRT
REKVYNPDIVVVLDPSLPTIVNVTDGLKKDGWVVLNSAKDEKTLREILGGFKGKLAVVDA
TKIAIEELGLPITNTTMLGAFLKATGLVDQEYLEEALEHRFGRLAEKNKAAMARAIKETK
IYA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgatagaggtaaggctccatggtaggggtggacagggagcagtgacttctgctgaattg
atagctatttctgctatcaatcagggtaattacgcccaggcatttcccagttttggtcct
gagcgccgaggtgcaccggttatggccttcgtacgcattagtgatcagcgcattcgtacc
cgtgaaaaggtctataatcctgatattgttgtcgttcttgatccttctcttcctactatt
gtgaatgttaccgatggtcttaaaaaagacgggtgggttgtcttaaattcagctaaagat
gaaaagactttacgagaaattttagggggttttaagggaaagctcgcggtggttgacgcc
accaaaatcgccatagaagagcttggcctgcctatcactaacaccaccatgttgggagcc
tttttaaaggctaccggcttagtggatcaagagtatcttgaagaagcccttgagcatcgt
tttggccgtctggctgaaaaaaacaaagcggccatggctcgggccattaaagaaactaaa
atttacgcctaa

DBGET integrated database retrieval system