KEGG   Thermodesulfatator indicus: Thein_1420Help
Entry
Thein_1420        CDS       T01546                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_1420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1420
   00020 Citrate cycle (TCA cycle)
    Thein_1420
   00620 Pyruvate metabolism
    Thein_1420
   00640 Propanoate metabolism
    Thein_1420
   00650 Butanoate metabolism
    Thein_1420
  Energy metabolism
   00680 Methane metabolism
    Thein_1420
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thein_1420
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thein_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1490570..1491748
Genome map
AA seq 392 aa AA seqDB search
MGKRIAKEVSIAIADAVKLARAEVIAAYPITPQTHIVEHLSELVANGELDAEYVTVESEH
SAMSVAIGAVATGARTFTSTAAQGLALMHEMLFIASAMRLPVVMVVANRALSAPISIWND
HSDIMANRDIGWIQVWAENGQEAVDLTIQAFRIAEDKNVMFPMIVNIDGFTLSHVIEPII
LPDQEEVDAFLPAFKPKYKLDPRKPITMGAVGVPEIYFEAKKAQDEAFRNTPRVIKRVWK
DWANRFGREYNPIETYRMEDAEVALLIMGSLAETAMTAVDKMRDEGKKVGLVRIRLWRPF
PVQEFRRAVSKVPVLAVIDRAMPPGAVNGPVATEVKAALYNAGRKPRVVNFIAGLGGRDV
TVEDFEEMADKAAFYRKKRPKELYETIGVRES
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaagaatagcgaaagaggtatctatagccattgccgatgccgttaagctggcc
cgggccgaggttattgcggcctatcctattaccccgcagacccacatcgtagagcacttg
agtgaactggtggccaatggtgagcttgatgctgaatatgttactgttgagtccgagcat
tcagctatgagtgtggccataggggctgtagctaccggagctcgcacctttacctctaca
gcagctcaggggctggccctaatgcacgaaatgctctttattgcttcggccatgaggctt
ccggtagtaatggtcgtagctaaccgcgctctttctgctcctattagtatctggaatgac
catagtgacattatggctaaccgagatattggctggattcaggtttgggcggaaaacggt
caggaagccgttgatcttactatccaggcctttcgtatagccgaagataaaaacgtcatg
ttccccatgatagtcaacattgatggtttcactctctctcacgttattgagcccataatc
cttcctgaccaggaagaagttgacgcctttttaccggcttttaagcctaaatacaagctt
gatcctaggaagcccatcaccatgggggcagtaggagttcctgaaatctactttgaggcc
aaaaaggcccaggacgaggcctttagaaatacgcctagagtaataaaacgggtgtggaaa
gattgggctaatcgcttcggccgggaatacaatcccattgaaacttatcgtatggaagac
gctgaagtggctttacttattatgggtagtctagcggaaacggctatgacagcggtagat
aagatgcgtgacgaaggcaaaaaagttggtctggtgcgtattaggctctggcggccgttc
cctgtgcaagaattcaggcgtgcggtttctaaggtgccggtgttggcggtgattgaccgg
gctatgcctcctggcgcagttaacggtccggtggctacggaagttaaggctgctctttac
aacgccgggcgcaaacccagggtggttaactttatcgccggccttggcggaagagatgta
accgttgaggactttgaagaaatggcagacaaggctgctttttaccgcaaaaaacgacct
aaagaattatacgaaacgataggggtgcgtgagtcatga

DBGET integrated database retrieval system