KEGG   Thermodesulfatator indicus: Thein_1421Help
Entry
Thein_1421        CDS       T01546                                 

Definition
(GenBank) thiamine pyrophosphate TPP-binding domain-containing protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00020  Citrate cycle (TCA cycle)
tid00620  Pyruvate metabolism
tid00633  Nitrotoluene degradation
tid00640  Propanoate metabolism
tid00650  Butanoate metabolism
tid00680  Methane metabolism
tid01100  Metabolic pathways
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
Module
tid_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1421
   00020 Citrate cycle (TCA cycle)
    Thein_1421
   00620 Pyruvate metabolism
    Thein_1421
   00640 Propanoate metabolism
    Thein_1421
   00650 Butanoate metabolism
    Thein_1421
  Energy metabolism
   00680 Methane metabolism
    Thein_1421
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Thein_1421
Enzymes [BR:tid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Thein_1421
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C
Motif
Other DBs
NCBI-ProteinID: AEH45287
UniProt: F8AA01
Position
1491745..1492683
Genome map
AA seq 312 aa AA seqDB search
MISEFSKFKGFSLKNLPEVEPIAPGHRGCQGCGEILALRMAMKALGTDVIVANATGCMEI
ITSPFPHTSWRVPWIHTAFENTAAVASGIEAALKVLKRRGRFPKSRHVDVVAVAGDGGTA
DIGLQALSGALERGHDFVYICLDNEAYMNTGVQRSSATPYGAMTTTSPPGERSFGQMTWK
KNVPQIAVAHGIPYVATASPAFFLDLMNKVKRAALVKGPAYVHIYSPCPTGWGSRGEDSI
KIARLAVDTKVFPLYEVIEGKYYITRKITKPKPVEEYLKTQRRFRHLTPEVIAEIQRRVD
AEYERLLKLAEI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgatatcagaattcagcaaattcaaaggtttttccttaaaaaatttaccggaagtggag
ccaattgctccgggtcacaggggatgtcagggctgtggcgaaattttggccctgcgtatg
gccatgaaggctttaggtacagacgtaattgtggccaacgccacgggatgtatggaaatt
attacctcgccctttccccatacttcctggcgggttccctggattcacactgcttttgaa
aataccgccgccgtggcttcaggaatagaagcggcgcttaaagtactcaaaagacgtggg
cgctttccaaaaagccgtcacgtagatgtagtagctgtggctggtgatggtggtacggca
gatattggccttcaggcgttatctggggctcttgagcgaggccatgattttgtttatatc
tgtttggataatgaagcttatatgaatactggggttcaacgttcaagtgctactccttac
ggtgctatgactaccaccagccccccaggtgaacgcagtttcggccagatgacctggaaa
aagaatgtgcctcaaattgccgtggcccatggtatcccttatgtggctacggctagtccg
gccttttttctggaccttatgaacaaagtcaaaagagcggctttggtaaaaggccctgct
tacgtgcatatttattccccgtgtccaacaggttggggttctcgcggggaagactccatt
aaaatagcgcgtttagcggtagataccaaagtctttcctctttacgaggtaattgaaggg
aagtactacatcacccgaaaaattaccaaacctaaaccagtagaagaatatttgaagact
cagcggcgttttcgtcatctcacccctgaggtgattgcggagattcaacgccgtgtagat
gctgagtacgaacgcctattaaaattggccgagatatag

DBGET integrated database retrieval system