KEGG   Thermodesulfatator indicus: Thein_1762Help
Entry
Thein_1762        CDS       T01546                                 

Definition
Alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Thein_1762
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Thein_1762
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Thein_1762
Enzymes [BR:tid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Thein_1762
Exosome [BR:tid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Thein_1762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1828135..1829649
Genome map
AA seq 504 aa AA seqDB search
MKQGVFRREFLACLATLVASFVFLLFVSVGQVEAGKAKYIFLFIGDGMGIPQRVAAEQFI
GEKLLMDKLPAQGITTTYAANRFITGSAAAATAIACGHKTNIGMIGITPDGQVIKSVAEL
ARDKGMKVGIISSVSIDHATPAGFYAHVKKRSQYYDIALQLAKSNFNFFGGGGFKDPNNK
KHNSVNYQGNAFDIIRNAGYRIIRDKNEFESLKKGDDKVIVINPRLPDGKAEPYAIDQTP
ADISLAELTDKAIQLLDNKKGFFIMVEGGKIDWACHANDAVTAIKDTLAFNDAIKVAYDF
YLKHPKDTLIVVTADHETGGLTLGFAGTKYASYFDVLHHQNISFKMFTDEIMKNLKKSKY
ITFEDVKPIITKYFGLKFSGDPSDPMVLKPYEIVQLVKAFEVSMKGKYDEHDPQLYLLYG
GYDPLTVTITHILNHKAGLAWTSYKHTGVPIQTTAVGIYADLFNGYYDNTDIAKKIMKAM
GITPKVYYVNNYSTETVRSLVANF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaggtgttttcagaagagagtttttagcttgtttagccactttggttgcgtca
tttgtttttcttttattcgtaagtgttggtcaagtagaagccggaaaagcgaaatacatt
tttctttttattggtgatggtatgggcattccacagcgtgtggctgccgaacagtttatt
ggtgaaaaactactgatggataaattaccagcccagggtataaccactacttacgctgct
aatcgttttattactggttctgcagcagcggctacagctattgcttgtggacataaaact
aatatcggtatgattggtataacacctgatgggcaggttattaaaagtgttgctgagtta
gctagagataaagggatgaaagttggtattatatctagtgtttcaattgatcatgctact
ccagctggtttttacgcgcacgtaaaaaaacgtagccaatactatgatattgcccttcag
ttagctaagagcaattttaacttttttggaggtggtggttttaaagaccctaacaataag
aaacataatagtgtaaactatcagggtaatgcttttgatattatacgtaatgccggatat
cgtatcattcgcgataaaaatgaatttgaaagtttgaaaaaaggagatgacaaagtaatt
gttattaatccacgcttaccagatggtaaagcagagccttatgctattgatcaaactcca
gctgatatttctcttgcagaattaacggataaagctattcagttattagataataaaaaa
ggcttttttattatggttgaaggaggtaagatagattgggcttgtcacgcaaatgatgct
gttacagctattaaagataccttagcttttaatgatgctattaaagtagcttatgacttt
tatttaaagcaccctaaggatactcttattgtagtgactgcggatcacgaaactggaggt
ttaaccttgggttttgctggcacaaaatatgctagctattttgacgtgctccatcatcaa
aatatatctttcaaaatgtttactgatgagattatgaaaaatttaaagaagagtaaatat
attaccttcgaagatgttaagcctataattactaaatattttggcctcaagttttctggt
gatccttctgatcctatggttttaaaaccttatgaaattgtacagttggtaaaagctttt
gaagttagcatgaaaggtaagtatgatgagcatgatcctcagctttatttgctttatggt
ggttatgatcctctcactgtaactattactcatatcttgaatcataaggcaggtcttgct
tggacatcttataaacatactggtgttcctattcaaacaactgctgtaggtatttatgct
gacttatttaatggttattacgataatactgatatagctaagaaaattatgaaagctatg
ggtatcactcctaaagtttactatgtaaataactattcaactgaaaccgtccgttcctta
gttgctaatttctaa

DBGET integrated database retrieval system