KEGG   Thermodesulfatator indicus: Thein_1778Help
Entry
Thein_1778        CDS       T01546                                 

Definition
coenzyme F420 hydrogenase/dehydrogenase subunit beta domain-containing protein
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:tid00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1846740..1847843
Genome map
AA seq 367 aa AA seqDB search
MKTFANLQEEVIQKGLCHRCGGCVSVCTAINYGALGFNEEGYPQYKDVEKCIECGVCYMV
CPEAAYEEEAFMKAIGWEPPIGPVLAVKVGRAISPEIRQRATDGGVVTALLVHLFKRGMI
DGAVVAKRISPFKVVPSLVTSAEEVIEAAGFYHDVSAGVQDWSEKYSTFAPSFEEMRPAM
VEKLKRVAIVGTPCQIHTLRKMQFFKVAPSETFYMLLGLFCSGHFNFDEAGRKKLEEIGG
FKWDDIAKINIKDALIITLQNGEVKRIPLDEVEDLKRPACKFCEDYAAEFADISFGGIGA
PDGWTSVIIRTPKARGAFADARRKTIEEFPLEEDPKLTEKVLETVKKATEIKKEKAKENK
KKYLNNG
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacttttgcgaatcttcaggaagaagtaatacaaaagggcttatgtcacaggtgt
ggtggttgtgtatctgtttgtaccgccattaactatggcgctttaggttttaatgaagaa
ggttatcctcaatacaaagatgtagaaaagtgtattgaatgtggtgtttgttacatggtg
tgccctgaggcggcctatgaggaagaggcctttatgaaagctattggctgggagccgccg
attgggccggtcttagctgttaaagttggccgtgctattagtccggaaattcgccagagg
gctacagatggcggagtggttaccgctcttttggtccatctcttcaaaagaggcatgatt
gacggggctgttgtggccaaacgaatcagtccttttaaagtagttccttctttggttact
tcagccgaagaggtgattgaagcggctggattttatcatgacgtttctgctggtgttcag
gattggagtgaaaaatatagtacttttgctccttcttttgaggaaatgcggccggctatg
gtagaaaagcttaaacgggtagccattgtaggaactccttgtcaaattcataccttacgt
aagatgcagttttttaaggtagctccttcagagactttttatatgcttttaggccttttc
tgttctgggcatttcaattttgacgaagctggtcgtaagaagcttgaagagataggtgga
ttcaagtgggatgacattgccaaaattaatattaaagacgctttgattattacactccaa
aatggagaagtgaaacgtattcctcttgatgaagtggaagaccttaaaagaccagcctgt
aaattctgtgaagattatgcggcggaatttgcagatatttcttttggtggtataggagcc
cctgatggctggacttcagttattattagaacaccaaaggcaaggggcgcttttgctgat
gcacgccgtaaaaccatagaagaattcccattggaagaagatcctaaacttaccgagaaa
gttctagaaacagtcaaaaaagccactgaaatcaaaaaagaaaaagccaaagaaaacaag
aaaaaatatttaaataacggataa

DBGET integrated database retrieval system