KEGG   Thermodesulfatator indicus: Thein_1875Help
Entry
Thein_1875        CDS       T01546                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tid  Thermodesulfatator indicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thein_1875
Enzymes [BR:tid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Thein_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1947900..1948769
Genome map
AA seq 289 aa AA seqDB search
MSRPLLRKMTFLGLSENPESAKIVFLPAPYDATTSFYPGTRFGPRRIIEASPYLEFYDEE
TDCEVYQKAPFLTLPEEELPIAPQNMLEELKRRLKPYLERNMFPVVLGGEHTVSLAPIEI
LAEKHPGLCVVQIDAHADLRESYQGSPYSHACTMRRALEYGIELFPIGIRAISREEMEFV
RDKGLEIFWAKDVVFKPHSIAQKISQRIGSRSVYVTIDLDGFDPSEVPGVGTPEPGGLKW
YDALVILKELAGLNVVGFDVVELLPADNRSPFFAAKLIYKFLSYLFCRI
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgtcccggcctttattgcgtaaaatgacttttctagggttatcggaaaatcctgaatcg
gccaaaatagtttttttgccagcaccttatgacgctacgacatctttttatcctggtacg
cgttttggcccgcgtcgtatcatagaggcaagcccttatcttgagttctacgacgaagaa
acagattgcgaggtttatcagaaagctccttttcttaccttacccgaagaagaactcccc
atagctccacaaaatatgcttgaggagctaaaaaggcgtcttaagccataccttgaaaga
aatatgtttccagtagtgcttggtggagagcatacggtcagcctggccccaatagagatt
ttggccgaaaaacatcctggtctttgcgtagtacaaatagacgctcacgcagatctgcga
gagagctatcaaggaagcccttattcacatgcttgcactatgagacgagctttagagtat
ggaatagagcttttccccataggaattcgtgctatttctcgcgaagaaatggagtttgtc
cgtgataaggggcttgagattttctgggctaaagatgtggtgtttaaacctcattctatc
gcccaaaagatttcccaaaggattggtagccggtcggtttatgtaactatagatcttgat
ggatttgatccttcagaagtgcctggagtgggtacaccggaaccaggggggctgaaatgg
tacgatgccctggttattttgaaagagcttgccggattaaacgtagtaggttttgatgtg
gtagaactcttacccgcagataatcgttctcctttttttgcggctaaattgatttataag
tttctttcatatttgttttgccgtatttga

DBGET integrated database retrieval system