KEGG   Thermodesulfatator indicus: Thein_1892Help
Entry
Thein_1892        CDS       T01546                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00010  Glycolysis / Gluconeogenesis
tid00030  Pentose phosphate pathway
tid00051  Fructose and mannose metabolism
tid00680  Methane metabolism
tid01100  Metabolic pathways
tid01110  Biosynthesis of secondary metabolites
tid01120  Microbial metabolism in diverse environments
tid01130  Biosynthesis of antibiotics
tid01200  Carbon metabolism
tid01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1892
   00030 Pentose phosphate pathway
    Thein_1892
   00051 Fructose and mannose metabolism
    Thein_1892
  Energy metabolism
   00680 Methane metabolism
    Thein_1892
Enzymes [BR:tid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thein_1892
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thein_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEH45747
UniProt: F8ACB1
Position
1965455..1966600
Genome map
AA seq 381 aa AA seqDB search
MKVTISVIKADIGGYVGHSSTHPEVVAKVEEYAKAGVEKGTLLDASVITCGDDIAIVMTH
TKGKDNEEIHKLAWDAFVAGTEVAKKLKLYGAGQDLLADAFSGNVKGMGPGVAEMEIEER
KSEPFIVYFADKTSPSAWNLALYEMFADPMNTAGLVIDPSMHDGFTFEVMDVYSGKAVKL
ETPRELYDLLVFIGATSRYVVRAVYRNRDGEIAAVASTQKLSLMAGRYVGKDDPVLIVRC
QSGFPAVGEALEPFARPWLVEGWMRGSHTGPLMPVSFKEAKPTRFDGPPRVIAAGYQLCE
GKLVGPNDLFDDPAFDDARNRCALLANQLRRQGIFEPHRLPPEEMEYTTLPKVLEKLKDR
FVDIGEPEAKAPGSGEGEIHE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttacgatttccgtgattaaagcggacattggtggttatgtagggcactcttct
actcatcctgaggtagtggcaaaagttgaagaatatgccaaggccggtgtagaaaaaggt
actttgcttgatgcttcagttattacctgtggtgatgacattgctattgttatgacccac
accaaaggcaaagacaatgaagaaatccacaaactagcctgggatgcttttgtagcaggc
actgaagtggccaaaaagttaaaactttacggtgccggccaggaccttttggctgatgct
ttttccggaaacgtaaaaggcatgggcccaggggttgctgaaatggaaattgaagagcgt
aaaagcgagccttttatcgtctattttgctgataagacttctcccagtgcctggaacctg
gccctttacgaaatgtttgctgaccctatgaacacagctggtctggtgattgatccttct
atgcacgatggctttacttttgaagtcatggatgtctattctggtaaagccgtaaagtta
gagacccctcgcgagctttatgaccttttagtctttatcggtgctaccagccgttacgtg
gtaagagcagtctatcgtaaccgcgatggcgaaattgcggcggtggcttctacccagaag
ctttcccttatggccggccgctacgtaggtaaggatgacccagtgcttatcgtccgttgc
cagagtggtttcccggccgttggtgaagcccttgagccttttgctcgtccatggttggta
gagggctggatgcgtggttctcataccgggccgcttatgccggtatcttttaaagaagct
aagcctacccgttttgacgggccaccacgggtgatagccgctgggtatcagctctgcgaa
ggaaagcttgttgggcccaatgacctctttgacgatccggcttttgatgacgctcgcaat
cgttgtgcgctactggctaaccagttgcgtcgtcagggtatttttgaaccgcatcgcttg
ccacctgaagaaatggaatacaccacactacctaaagtgcttgaaaagcttaaagatcgc
tttgttgacattggtgagcctgaggctaaggccccaggttctggtgagggagaaatccac
gaataa

DBGET integrated database retrieval system