KEGG   Thermodesulfatator indicus: Thein_1892Help
Entry
Thein_1892        CDS       T01546                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tid  Thermodesulfatator indicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Thein_1892
   01230 Biosynthesis of amino acids
    Thein_1892
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Thein_1892
   00030 Pentose phosphate pathway
    Thein_1892
   00051 Fructose and mannose metabolism
    Thein_1892
  Energy metabolism
   00680 Methane metabolism
    Thein_1892
Enzymes [BR:tid01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Thein_1892
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Thein_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1965455..1966600
Genome map
AA seq 381 aa AA seqDB search
MKVTISVIKADIGGYVGHSSTHPEVVAKVEEYAKAGVEKGTLLDASVITCGDDIAIVMTH
TKGKDNEEIHKLAWDAFVAGTEVAKKLKLYGAGQDLLADAFSGNVKGMGPGVAEMEIEER
KSEPFIVYFADKTSPSAWNLALYEMFADPMNTAGLVIDPSMHDGFTFEVMDVYSGKAVKL
ETPRELYDLLVFIGATSRYVVRAVYRNRDGEIAAVASTQKLSLMAGRYVGKDDPVLIVRC
QSGFPAVGEALEPFARPWLVEGWMRGSHTGPLMPVSFKEAKPTRFDGPPRVIAAGYQLCE
GKLVGPNDLFDDPAFDDARNRCALLANQLRRQGIFEPHRLPPEEMEYTTLPKVLEKLKDR
FVDIGEPEAKAPGSGEGEIHE
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttacgatttccgtgattaaagcggacattggtggttatgtagggcactcttct
actcatcctgaggtagtggcaaaagttgaagaatatgccaaggccggtgtagaaaaaggt
actttgcttgatgcttcagttattacctgtggtgatgacattgctattgttatgacccac
accaaaggcaaagacaatgaagaaatccacaaactagcctgggatgcttttgtagcaggc
actgaagtggccaaaaagttaaaactttacggtgccggccaggaccttttggctgatgct
ttttccggaaacgtaaaaggcatgggcccaggggttgctgaaatggaaattgaagagcgt
aaaagcgagccttttatcgtctattttgctgataagacttctcccagtgcctggaacctg
gccctttacgaaatgtttgctgaccctatgaacacagctggtctggtgattgatccttct
atgcacgatggctttacttttgaagtcatggatgtctattctggtaaagccgtaaagtta
gagacccctcgcgagctttatgaccttttagtctttatcggtgctaccagccgttacgtg
gtaagagcagtctatcgtaaccgcgatggcgaaattgcggcggtggcttctacccagaag
ctttcccttatggccggccgctacgtaggtaaggatgacccagtgcttatcgtccgttgc
cagagtggtttcccggccgttggtgaagcccttgagccttttgctcgtccatggttggta
gagggctggatgcgtggttctcataccgggccgcttatgccggtatcttttaaagaagct
aagcctacccgttttgacgggccaccacgggtgatagccgctgggtatcagctctgcgaa
ggaaagcttgttgggcccaatgacctctttgacgatccggcttttgatgacgctcgcaat
cgttgtgcgctactggctaaccagttgcgtcgtcagggtatttttgaaccgcatcgcttg
ccacctgaagaaatggaatacaccacactacctaaagtgcttgaaaagcttaaagatcgc
tttgttgacattggtgagcctgaggctaaggccccaggttctggtgagggagaaatccac
gaataa

DBGET integrated database retrieval system