KEGG   Thermodesulfatator indicus: Thein_1928Help
Entry
Thein_1928        CDS       T01546                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tid  Thermodesulfatator indicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2005496..2006278
Genome map
AA seq 260 aa AA seqDB search
MRKYLPIACFFLLIIAIQAEAADENFVKLCRESFKRDFPVSAEKARILPSPVRGLCELHL
GLNVVYYAPPSEPDKKGYLLVGEIYTPEGKNITVEARERLATDVVKKLDLSKAIKIGTGP
VKVIEFTDPDCPFCRRLERFFAQNPELTAKITRYVFLYPLTKLHPGAEKHARWILCQKEP
DKALVDLMIGKIVKPEISEQCDLQSVEEHLSYSRNIAGELGIRGTPFLIAGRTVVSGFNP
GLIYTGINRWLRAEHAKNKH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatatttaccaatagcctgctttttccttttgataatagcgattcaggcagaa
gctgcggatgaaaatttcgtaaaattatgcagggaatccttcaaaagggattttcccgta
tccgccgaaaaggcccggattttaccttcccccgtcaggggactatgtgagctgcatctc
gggctaaatgtagtctattatgctccaccgtccgaacccgataaaaagggctatcttctt
gtgggggaaatttacacgccggagggaaaaaatatcaccgttgaagcccgtgagcgcctg
gcaaccgatgttgtaaaaaaacttgatttatcgaaggctataaagataggaaccggcccc
gttaaagtaatagagtttaccgatcccgactgtcccttctgtcgtcgtcttgagaggttt
ttcgctcaaaatccggaattaaccgcaaagattaccagatatgtgtttctctatcctcta
acgaagctacatcccggggcagaaaaacacgcccgctggattctatgtcagaaagagccc
gataaagcgctggttgacctgatgataggtaaaattgtcaaacctgaaatttctgaacaa
tgtgatcttcagagtgtagaggaacatctctcatattctcgaaacatagccggagaactc
ggtattcgcggtacccctttccttattgcgggtagaacggtggtttcggggtttaatccc
ggcctgatttataccggcattaatcggtggcttcgcgcggagcacgctaaaaataaacat
taa

DBGET integrated database retrieval system