KEGG   Thermodesulfatator indicus: Thein_1997Help
Entry
Thein_1997        CDS       T01546                                 

Definition
Magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tid  Thermodesulfatator indicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Thein_1997
Enzymes [BR:tid01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Thein_1997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2065070..2066053)
Genome map
AA seq 327 aa AA seqDB search
MRKIYPFSAIVGQDEMKLALILNVIDPSIGGVLIRGEKGTGKSTIVRSLADILPEIEVVE
GCPYSCDPESPAELCPECQKSLEEGPLPRVKRKVRVVDLPLSATEDRLVGTLDIERALKT
GEKHFEPGILAAAHRGILYVDEINLLEDHLVDLLLDAAAMGVNFVEREGISFSHPARFVL
VGTMNPEEGELRPQLLDRFGLCVQVEGIKDPKERVLVIERRMAFEKDPEGFSRKFAEENK
KLAERIVEAQNLLNEVEISEEVLYQVAKKLITIGVDGHRGDLTVVKTARAHAAFCGRKAI
TDEDLKVAEALALPHRLRRRPFEEIAF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaatttaccctttctcagccattgtggggcaggacgagatgaagcttgccctc
attctcaatgttatagacccgtccatcggcggagtgcttatcaggggagaaaaagggaca
ggcaaatcaaccatcgtgcgctcgctcgctgacatcttgccagaaatagaagtggtagag
ggctgtccctattcctgcgacccggagagccctgctgaactttgcccggagtgccagaaa
agccttgaagaaggccctcttccccgggtaaaacgaaaagtccgggtggttgacctgcct
ctttcagccactgaagatcgcctggtaggcactcttgacatagaacgcgcccttaaaacc
ggtgaaaagcactttgagccagggattcttgcggccgctcatcggggtatcctttacgtg
gacgaaataaatctccttgaagaccacctggttgaccttttgcttgacgccgccgccatg
ggtgtaaacttcgtggaacgggaaggaataagcttttctcacccggcgaggttcgtgctg
gtggggaccatgaacccggaagaaggggaacttaggccccaactccttgaccgctttggc
ctctgcgtccaggtagagggcataaaagaccctaaagaaagggtgctcgtaatagaaaga
cgcatggcttttgagaaagaccctgaaggctttagccgcaagtttgccgaggaaaataaa
aagctagcagagcgtatagttgaagcccaaaatcttcttaatgaagtagaaatctcagaa
gaagttctttaccaggtagccaaaaaacttatcaccattggcgtggacggccatcgtgga
gacttaaccgtagtaaaaaccgcccgggcccacgccgccttttgcggaagaaaagcaatc
accgatgaagacctaaaagtggccgaggccctggccctacctcatcggctacggcgaaga
ccatttgaagaaatagccttttaa

DBGET integrated database retrieval system