KEGG   Thermodesulfatator indicus: Thein_2140Help
Entry
Thein_2140        CDS       T01546                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tid  Thermodesulfatator indicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thein_2140
   00052 Galactose metabolism
    Thein_2140
   00500 Starch and sucrose metabolism
    Thein_2140
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_2140
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thein_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2218485..2219366)
Genome map
AA seq 293 aa AA seqDB search
MSHSTIRKAVLPVAGLGTRFLPATKAIPKEMLTVVDRPTIQYIVEEAVNSGVKQVILVTS
SGKSAIENHFDYSYELESYLEAKGKLKLLEEVRRVTNLIEDIISVRQKKPLGLGHAIYVT
RHVVGREPFAVLLGDDLVDSEIPCLKQMIEIFGEFKGPVIAVQRVPKEEIFRYGIVAGEK
VGDRIIRVREMKEKPEPGEIDSDLAIIGRYILIPEIYDYLARTKPGVGGEIQLTDALSAL
KDDYPVYAYEFEGTRYDAGDKFGFMQAVITFALKHPEIGEKVKQFLKEKINNL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctcattctactattagaaaggctgttcttccggtagcagggcttggcacgcgcttt
ttgccggccactaaggccattcctaaagaaatgttaaccgtggttgaccgtcctaccatt
caatatatcgtagaagaggccgttaactccggggtaaaacaggtaatcttagtaacgtct
tctgggaaatcggccattgaaaaccactttgactactcctatgaactagaatcttacctt
gaggccaaaggtaagctaaagctccttgaagaagttagacgggtaaccaacttaatagaa
gatattatctcggtacgccagaaaaagcccctaggtctcgggcatgcaatttatgtaacc
cggcatgtggtagggcgtgaaccctttgccgtgcttttgggagatgacctggtagattca
gagattccctgccttaagcagatgatagaaatttttggagaatttaagggcccggttata
gccgtgcaacgggttcccaaagaggaaatttttcgttacggcatagtggctggcgaaaaa
gtgggagataggattatcagagtgcgagagatgaaagaaaagcccgaaccaggagaaatt
gattctgacttagctattatcggccgctacattttgattccagagatttacgattaccta
gccaggaccaagcccggagttggtggcgaaatccagctaaccgacgccctttcagcttta
aaagacgactacccggtttatgcttacgaatttgaaggcacccgttacgatgccggagat
aaatttggttttatgcaagcagttataacttttgccctaaaacatccagagataggagaa
aaggtcaaacaatttttaaaagaaaaaattaataatctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system