KEGG   Thermodesulfatator indicus: Thein_2140Help
Entry
Thein_2140        CDS       T01546                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tid  Thermodesulfatator indicus
Pathway
tid00040  Pentose and glucuronate interconversions
tid00052  Galactose metabolism
tid00500  Starch and sucrose metabolism
tid00520  Amino sugar and nucleotide sugar metabolism
tid01100  Metabolic pathways
tid01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tid00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Thein_2140
   00052 Galactose metabolism
    Thein_2140
   00500 Starch and sucrose metabolism
    Thein_2140
   00520 Amino sugar and nucleotide sugar metabolism
    Thein_2140
Enzymes [BR:tid01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Thein_2140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 NAD_binding_10
Motif
Other DBs
NCBI-ProteinID: AEH45988
UniProt: F8A9T3
Position
complement(2218485..2219366)
Genome map
AA seq 293 aa AA seqDB search
MSHSTIRKAVLPVAGLGTRFLPATKAIPKEMLTVVDRPTIQYIVEEAVNSGVKQVILVTS
SGKSAIENHFDYSYELESYLEAKGKLKLLEEVRRVTNLIEDIISVRQKKPLGLGHAIYVT
RHVVGREPFAVLLGDDLVDSEIPCLKQMIEIFGEFKGPVIAVQRVPKEEIFRYGIVAGEK
VGDRIIRVREMKEKPEPGEIDSDLAIIGRYILIPEIYDYLARTKPGVGGEIQLTDALSAL
KDDYPVYAYEFEGTRYDAGDKFGFMQAVITFALKHPEIGEKVKQFLKEKINNL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgtctcattctactattagaaaggctgttcttccggtagcagggcttggcacgcgcttt
ttgccggccactaaggccattcctaaagaaatgttaaccgtggttgaccgtcctaccatt
caatatatcgtagaagaggccgttaactccggggtaaaacaggtaatcttagtaacgtct
tctgggaaatcggccattgaaaaccactttgactactcctatgaactagaatcttacctt
gaggccaaaggtaagctaaagctccttgaagaagttagacgggtaaccaacttaatagaa
gatattatctcggtacgccagaaaaagcccctaggtctcgggcatgcaatttatgtaacc
cggcatgtggtagggcgtgaaccctttgccgtgcttttgggagatgacctggtagattca
gagattccctgccttaagcagatgatagaaatttttggagaatttaagggcccggttata
gccgtgcaacgggttcccaaagaggaaatttttcgttacggcatagtggctggcgaaaaa
gtgggagataggattatcagagtgcgagagatgaaagaaaagcccgaaccaggagaaatt
gattctgacttagctattatcggccgctacattttgattccagagatttacgattaccta
gccaggaccaagcccggagttggtggcgaaatccagctaaccgacgccctttcagcttta
aaagacgactacccggtttatgcttacgaatttgaaggcacccgttacgatgccggagat
aaatttggttttatgcaagcagttataacttttgccctaaaacatccagagataggagaa
aaggtcaaacaatttttaaaagaaaaaattaataatctttag

DBGET integrated database retrieval system